BLASTX nr result
ID: Rehmannia29_contig00012413
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00012413 (829 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26243.1| Molecular chaperone (DnaJ superfamily) [Handroant... 101 2e-23 ref|XP_011092835.1| mitochondrial import inner membrane transloc... 101 2e-23 ref|XP_012830994.1| PREDICTED: mitochondrial import inner membra... 100 9e-23 ref|XP_022856408.1| mitochondrial import inner membrane transloc... 99 2e-22 gb|KZV48169.1| hypothetical protein F511_25958 [Dorcoceras hygro... 99 3e-22 ref|XP_019162613.1| PREDICTED: mitochondrial import inner membra... 97 7e-22 ref|XP_021601627.1| mitochondrial import inner membrane transloc... 97 1e-21 ref|XP_006363675.1| PREDICTED: mitochondrial import inner membra... 96 2e-21 ref|XP_004249683.1| PREDICTED: mitochondrial import inner membra... 96 2e-21 gb|PHT36438.1| Mitochondrial import inner membrane translocase s... 96 3e-21 ref|XP_016543087.1| PREDICTED: mitochondrial import inner membra... 96 3e-21 ref|XP_021603643.1| mitochondrial import inner membrane transloc... 96 4e-21 ref|XP_020578133.1| mitochondrial import inner membrane transloc... 94 4e-21 ref|XP_012086854.1| mitochondrial import inner membrane transloc... 95 5e-21 ref|XP_021656851.1| mitochondrial import inner membrane transloc... 95 7e-21 ref|XP_007207505.1| mitochondrial import inner membrane transloc... 95 7e-21 ref|XP_020578131.1| mitochondrial import inner membrane transloc... 94 1e-20 ref|XP_015055734.1| PREDICTED: mitochondrial import inner membra... 94 1e-20 ref|XP_008449278.1| PREDICTED: mitochondrial import inner membra... 94 1e-20 ref|XP_008239236.1| PREDICTED: mitochondrial import inner membra... 94 1e-20 >gb|PIN26243.1| Molecular chaperone (DnaJ superfamily) [Handroanthus impetiginosus] Length = 112 Score = 101 bits (252), Expect = 2e-23 Identities = 49/53 (92%), Positives = 52/53 (98%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGKSKSSDSAF Sbjct: 60 VRESTPPDKVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKSKSSDSAF 112 >ref|XP_011092835.1| mitochondrial import inner membrane translocase subunit TIM14-1 [Sesamum indicum] Length = 112 Score = 101 bits (251), Expect = 2e-23 Identities = 48/53 (90%), Positives = 52/53 (98%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGK+KSSDSAF Sbjct: 60 VRESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSDSAF 112 >ref|XP_012830994.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Erythranthe guttata] gb|EYU42589.1| hypothetical protein MIMGU_mgv1a016665mg [Erythranthe guttata] Length = 112 Score = 99.8 bits (247), Expect = 9e-23 Identities = 46/53 (86%), Positives = 52/53 (98%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK++++GKSKSSDSAF Sbjct: 60 VRESTPQDKVREAHRRVMVANHPDAGGSHYLASKINEAKDIMMGKSKSSDSAF 112 >ref|XP_022856408.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Olea europaea var. sylvestris] Length = 112 Score = 98.6 bits (244), Expect = 2e-22 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK++L+GKSKSS SAF Sbjct: 60 VRESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDILMGKSKSSGSAF 112 >gb|KZV48169.1| hypothetical protein F511_25958 [Dorcoceras hygrometricum] Length = 132 Score = 99.0 bits (245), Expect = 3e-22 Identities = 45/53 (84%), Positives = 52/53 (98%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK+++LGKS++SDSAF Sbjct: 80 VRESTPADKVREAHRRVMVANHPDAGGSHYLASKINEAKDIILGKSRNSDSAF 132 >ref|XP_019162613.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-3-like [Ipomoea nil] Length = 112 Score = 97.4 bits (241), Expect = 7e-22 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKV+EAHRRVMVANHPDAGGSHY+ASKINEAK+VLLGK+KSS SAF Sbjct: 60 VRESTPADKVKEAHRRVMVANHPDAGGSHYLASKINEAKDVLLGKTKSSGSAF 112 >ref|XP_021601627.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Manihot esculenta] gb|OAY56499.1| hypothetical protein MANES_02G021600 [Manihot esculenta] Length = 112 Score = 96.7 bits (239), Expect = 1e-21 Identities = 46/53 (86%), Positives = 50/53 (94%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 IRESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK++LLGK+K S SAF Sbjct: 60 IRESTPSDKVREAHRRVMVANHPDAGGSHYLASKINEAKDILLGKAKGSGSAF 112 >ref|XP_006363675.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Solanum tuberosum] Length = 112 Score = 96.3 bits (238), Expect = 2e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHR+VMVANHPDAGGSHY+ASKINEAK+++LGKSK+S SAF Sbjct: 60 VRESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDIMLGKSKNSGSAF 112 >ref|XP_004249683.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Solanum lycopersicum] Length = 112 Score = 96.3 bits (238), Expect = 2e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHR+VMVANHPDAGGSHY+ASKINEAK+++LGKSK+S SAF Sbjct: 60 VRESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDIMLGKSKNSGSAF 112 >gb|PHT36438.1| Mitochondrial import inner membrane translocase subunit TIM14, partial [Capsicum baccatum] gb|PHT70604.1| Mitochondrial import inner membrane translocase subunit TIM14, partial [Capsicum annuum] gb|PHU05142.1| Mitochondrial import inner membrane translocase subunit TIM14, partial [Capsicum chinense] Length = 112 Score = 95.9 bits (237), Expect = 3e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHR+VMVANHPDAGGSHY+ASKINEAK++LLGK+K+S SAF Sbjct: 60 VRESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTKNSGSAF 112 >ref|XP_016543087.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Capsicum annuum] Length = 112 Score = 95.9 bits (237), Expect = 3e-21 Identities = 44/53 (83%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHR+VMVANHPDAGGSHY+ASKINEAK++LLGK+K+S SAF Sbjct: 60 VRESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTKNSGSAF 112 >ref|XP_021603643.1| mitochondrial import inner membrane translocase subunit TIM14-1-like [Manihot esculenta] gb|OAY58005.1| hypothetical protein MANES_02G141900 [Manihot esculenta] Length = 112 Score = 95.5 bits (236), Expect = 4e-21 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 IRESTP+DKV+EAHRRVMVANHPDAGGSHY+ASKINEAK++LLGKSK SAF Sbjct: 60 IRESTPVDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDLLLGKSKVGGSAF 112 >ref|XP_020578133.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X2 [Phalaenopsis equestris] Length = 76 Score = 94.4 bits (233), Expect = 4e-21 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DK+REAHR+VMVANHPDAGGSHY+ASKINEAK+VLLGKSK SAF Sbjct: 24 VRESTPPDKIREAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKSKGGGSAF 76 >ref|XP_012086854.1| mitochondrial import inner membrane translocase subunit TIM14-1 [Jatropha curcas] Length = 112 Score = 95.1 bits (235), Expect = 5e-21 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKV+EAHRRVMVANHPDAGGSHY+ASKINEAK++LLGK K S SAF Sbjct: 60 VRESTPTDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDILLGKGKGSGSAF 112 >ref|XP_021656851.1| mitochondrial import inner membrane translocase subunit TIM14-3-like [Hevea brasiliensis] Length = 112 Score = 94.7 bits (234), Expect = 7e-21 Identities = 45/53 (84%), Positives = 50/53 (94%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 IRESTP DKV+EAHRRVMVANHPDAGGSHY+ASKINEAK++LLGK+K S SAF Sbjct: 60 IRESTPSDKVKEAHRRVMVANHPDAGGSHYLASKINEAKDMLLGKAKGSGSAF 112 >ref|XP_007207505.1| mitochondrial import inner membrane translocase subunit TIM14-3 [Prunus persica] gb|ONI03128.1| hypothetical protein PRUPE_6G240700 [Prunus persica] Length = 112 Score = 94.7 bits (234), Expect = 7e-21 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK++LLG+SK SAF Sbjct: 60 VRESTPTDKVREAHRRVMVANHPDAGGSHYLASKINEAKDILLGRSKGMGSAF 112 >ref|XP_020578131.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X1 [Phalaenopsis equestris] ref|XP_020578132.1| mitochondrial import inner membrane translocase subunit TIM14-3-like isoform X1 [Phalaenopsis equestris] Length = 112 Score = 94.4 bits (233), Expect = 1e-20 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DK+REAHR+VMVANHPDAGGSHY+ASKINEAK+VLLGKSK SAF Sbjct: 60 VRESTPPDKIREAHRKVMVANHPDAGGSHYLASKINEAKDVLLGKSKGGGSAF 112 >ref|XP_015055734.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Solanum pennellii] Length = 112 Score = 94.4 bits (233), Expect = 1e-20 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHR+VMVANHPDAGGSHY+ASKINEAK+++LG SK+S SAF Sbjct: 60 VRESTPADKVREAHRKVMVANHPDAGGSHYLASKINEAKDIMLGNSKNSGSAF 112 >ref|XP_008449278.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1 [Cucumis melo] Length = 112 Score = 94.4 bits (233), Expect = 1e-20 Identities = 43/53 (81%), Positives = 51/53 (96%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 IRESTP DKV+EAHR+VMVANHPDAGGSHY+ASKINEAK++LLGK++ S+SAF Sbjct: 60 IRESTPTDKVKEAHRKVMVANHPDAGGSHYLASKINEAKDILLGKTRGSNSAF 112 >ref|XP_008239236.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM14-1-like [Prunus mume] ref|XP_021833975.1| mitochondrial import inner membrane translocase subunit TIM14-1-like [Prunus avium] Length = 112 Score = 94.4 bits (233), Expect = 1e-20 Identities = 43/53 (81%), Positives = 50/53 (94%) Frame = -3 Query: 170 IRESTPIDKVREAHRRVMVANHPDAGGSHYVASKINEAKEVLLGKSKSSDSAF 12 +RESTP DKVREAHRRVMVANHPDAGGSHY+ASKINEAK++LLG++K + SAF Sbjct: 60 VRESTPTDKVREAHRRVMVANHPDAGGSHYLASKINEAKDILLGRTKGTGSAF 112