BLASTX nr result
ID: Rehmannia29_contig00012389
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00012389 (436 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM99119.1| hypothetical protein CDL12_28390 [Handroanthus im... 54 8e-07 ref|XP_011099103.1| uncharacterized protein At4g06744-like [Sesa... 57 2e-06 gb|PIN01118.1| hypothetical protein CDL12_26376 [Handroanthus im... 54 2e-06 >gb|PIM99119.1| hypothetical protein CDL12_28390 [Handroanthus impetiginosus] Length = 71 Score = 53.5 bits (127), Expect = 8e-07 Identities = 26/46 (56%), Positives = 32/46 (69%) Frame = -3 Query: 431 SCPDPTTFNIIPCKIDYSALPEETEVNRKLMARLPRSYAALEKHRP 294 SCP P+ NI+PCKID SA EE+E + PRSYAAL++HRP Sbjct: 25 SCPYPSELNIVPCKIDASASTEESE---PMAMAPPRSYAALQRHRP 67 >ref|XP_011099103.1| uncharacterized protein At4g06744-like [Sesamum indicum] Length = 487 Score = 56.6 bits (135), Expect = 2e-06 Identities = 29/48 (60%), Positives = 35/48 (72%), Gaps = 1/48 (2%) Frame = -3 Query: 434 QSCPDPTTF-NIIPCKIDYSALPEETEVNRKLMARLPRSYAALEKHRP 294 QSCPDP + N +PCKID PEE +RKLMA+ PRSYAAL+ H+P Sbjct: 441 QSCPDPQSLINYMPCKIDNHESPEEYPEDRKLMAQ-PRSYAALQNHQP 487 >gb|PIN01118.1| hypothetical protein CDL12_26376 [Handroanthus impetiginosus] Length = 142 Score = 54.3 bits (129), Expect = 2e-06 Identities = 26/46 (56%), Positives = 33/46 (71%) Frame = -3 Query: 431 SCPDPTTFNIIPCKIDYSALPEETEVNRKLMARLPRSYAALEKHRP 294 SCP+P+ NI+PCKID SA EE+E + PRSYAAL++HRP Sbjct: 96 SCPNPSELNIVPCKIDASASTEESE---PMGMAPPRSYAALQRHRP 138