BLASTX nr result
ID: Rehmannia29_contig00011988
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00011988 (401 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011096369.1| OPA3-like protein [Sesamum indicum] 83 3e-17 ref|XP_006361044.1| PREDICTED: optic atrophy 3 protein homolog [... 82 6e-17 ref|XP_022861043.1| OPA3-like protein isoform X2 [Olea europaea ... 80 7e-17 gb|PHT69856.1| hypothetical protein T459_24960 [Capsicum annuum]... 82 8e-17 gb|PHT35733.1| hypothetical protein CQW23_23433 [Capsicum baccatum] 82 8e-17 gb|PIN06040.1| putative coiled-coil protein [Handroanthus impeti... 81 1e-16 gb|EPS67191.1| hypothetical protein M569_07588, partial [Genlise... 81 1e-16 ref|XP_019175781.1| PREDICTED: OPA3-like protein [Ipomoea nil] 80 2e-16 ref|XP_015089557.1| PREDICTED: optic atrophy 3 protein homolog [... 80 2e-16 ref|XP_009780208.1| PREDICTED: OPA3-like protein [Nicotiana sylv... 81 3e-16 ref|XP_019235325.1| PREDICTED: OPA3-like protein [Nicotiana atte... 80 3e-16 ref|XP_009597398.1| PREDICTED: OPA3-like protein [Nicotiana tome... 80 5e-16 ref|XP_012849371.1| PREDICTED: OPA3-like protein [Erythranthe gu... 79 6e-16 ref|XP_022892389.1| OPA3-like protein [Olea europaea var. sylves... 79 7e-16 gb|OIT25134.1| hypothetical protein A4A49_59196 [Nicotiana atten... 77 1e-15 ref|XP_004248125.1| PREDICTED: OPA3-like protein isoform X2 [Sol... 78 2e-15 ref|XP_020270456.1| optic atrophy 3 protein homolog [Asparagus o... 78 2e-15 ref|XP_019235717.1| PREDICTED: optic atrophy 3 protein homolog [... 77 4e-15 ref|XP_009776510.1| PREDICTED: OPA3-like protein [Nicotiana sylv... 77 4e-15 ref|XP_009589158.1| PREDICTED: optic atrophy 3 protein homolog [... 77 4e-15 >ref|XP_011096369.1| OPA3-like protein [Sesamum indicum] Length = 169 Score = 82.8 bits (203), Expect = 3e-17 Identities = 38/43 (88%), Positives = 42/43 (97%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFR++I+SVAQANHRITTTMQRRIYGH Sbjct: 17 SKPIAARLKKEAGLHPKFRNIIVSVAQANHRITTTMQRRIYGH 59 >ref|XP_006361044.1| PREDICTED: optic atrophy 3 protein homolog [Solanum tuberosum] Length = 169 Score = 82.0 bits (201), Expect = 6e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFR+ IIS+AQANHRITTTMQRRIYGH Sbjct: 17 SKPIAARLKKEAGLHPKFRNFIISIAQANHRITTTMQRRIYGH 59 >ref|XP_022861043.1| OPA3-like protein isoform X2 [Olea europaea var. sylvestris] Length = 109 Score = 80.1 bits (196), Expect = 7e-17 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFR+LIIS+AQANHR+TTT+QRRIYGH Sbjct: 17 SKPIAARLKKEAGLHPKFRNLIISMAQANHRMTTTVQRRIYGH 59 >gb|PHT69856.1| hypothetical protein T459_24960 [Capsicum annuum] gb|PHU04366.1| hypothetical protein BC332_25188 [Capsicum chinense] Length = 169 Score = 81.6 bits (200), Expect = 8e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFRS IIS+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIAARLKKEAGIHPKFRSFIISIAQANHRMTTTMQRRIYGH 59 >gb|PHT35733.1| hypothetical protein CQW23_23433 [Capsicum baccatum] Length = 169 Score = 81.6 bits (200), Expect = 8e-17 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFRS IIS+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIAARLKKEAGIHPKFRSFIISIAQANHRMTTTMQRRIYGH 59 >gb|PIN06040.1| putative coiled-coil protein [Handroanthus impetiginosus] Length = 167 Score = 81.3 bits (199), Expect = 1e-16 Identities = 38/43 (88%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KK+AG HPKFR+ IISVAQANHRITTTMQRRIYGH Sbjct: 17 SKPIAARLKKQAGLHPKFRNFIISVAQANHRITTTMQRRIYGH 59 >gb|EPS67191.1| hypothetical protein M569_07588, partial [Genlisea aurea] Length = 156 Score = 80.9 bits (198), Expect = 1e-16 Identities = 37/43 (86%), Positives = 42/43 (97%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAARIK EAGRHP+FR++IIS+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIAARIKVEAGRHPRFRNVIISIAQANHRMTTTMQRRIYGH 59 >ref|XP_019175781.1| PREDICTED: OPA3-like protein [Ipomoea nil] Length = 169 Score = 80.5 bits (197), Expect = 2e-16 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA R+KKEAGRHP FR+LI+S AQANHRITTTMQRRIYGH Sbjct: 17 SKPIAGRLKKEAGRHPTFRNLIVSFAQANHRITTTMQRRIYGH 59 >ref|XP_015089557.1| PREDICTED: optic atrophy 3 protein homolog [Solanum pennellii] Length = 169 Score = 80.5 bits (197), Expect = 2e-16 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA R+KKEAG HPKFR+ IIS+AQANHRITTTMQRRIYGH Sbjct: 17 SKPIAVRLKKEAGLHPKFRNFIISIAQANHRITTTMQRRIYGH 59 >ref|XP_009780208.1| PREDICTED: OPA3-like protein [Nicotiana sylvestris] ref|XP_016472603.1| PREDICTED: OPA3-like protein [Nicotiana tabacum] Length = 193 Score = 80.9 bits (198), Expect = 3e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFR LIIS+AQANHR+TTTMQRR+YGH Sbjct: 41 SKPIAARLKKEAGLHPKFRHLIISIAQANHRMTTTMQRRLYGH 83 >ref|XP_019235325.1| PREDICTED: OPA3-like protein [Nicotiana attenuata] gb|OIT26164.1| hypothetical protein A4A49_33298 [Nicotiana attenuata] Length = 169 Score = 80.1 bits (196), Expect = 3e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFR LIIS+AQANHR+TTTMQRR+YGH Sbjct: 17 SKPIAARLKKEAGLHPKFRHLIISMAQANHRMTTTMQRRLYGH 59 >ref|XP_009597398.1| PREDICTED: OPA3-like protein [Nicotiana tomentosiformis] ref|XP_016432552.1| PREDICTED: OPA3-like protein [Nicotiana tabacum] Length = 193 Score = 80.1 bits (196), Expect = 5e-16 Identities = 37/43 (86%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+KKEAG HPKFR LIIS+AQANHR+TTTMQRR+YGH Sbjct: 41 SKPIAARLKKEAGLHPKFRHLIISMAQANHRMTTTMQRRLYGH 83 >ref|XP_012849371.1| PREDICTED: OPA3-like protein [Erythranthe guttata] gb|EYU28025.1| hypothetical protein MIMGU_mgv1a015094mg [Erythranthe guttata] Length = 168 Score = 79.3 bits (194), Expect = 6e-16 Identities = 35/43 (81%), Positives = 42/43 (97%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+K++AG HPKFR++I+SVAQANHRITTTMQRR+YGH Sbjct: 17 SKPIAARLKQQAGLHPKFRNIIVSVAQANHRITTTMQRRLYGH 59 >ref|XP_022892389.1| OPA3-like protein [Olea europaea var. sylvestris] Length = 174 Score = 79.3 bits (194), Expect = 7e-16 Identities = 36/43 (83%), Positives = 42/43 (97%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIAAR+K+EAG HP+FR+LIIS+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIAARLKREAGLHPRFRNLIISMAQANHRMTTTMQRRIYGH 59 >gb|OIT25134.1| hypothetical protein A4A49_59196 [Nicotiana attenuata] Length = 126 Score = 77.4 bits (189), Expect = 1e-15 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA+R+K++AG HPKFR+ I+S+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIASRLKQQAGLHPKFRNFIVSIAQANHRVTTTMQRRIYGH 59 >ref|XP_004248125.1| PREDICTED: OPA3-like protein isoform X2 [Solanum lycopersicum] Length = 179 Score = 78.2 bits (191), Expect = 2e-15 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA R+KKEAG HPKFR+ IIS+AQANHRITTTMQRRIY H Sbjct: 17 SKPIAVRLKKEAGLHPKFRNFIISIAQANHRITTTMQRRIYSH 59 >ref|XP_020270456.1| optic atrophy 3 protein homolog [Asparagus officinalis] gb|ONK66740.1| uncharacterized protein A4U43_C06F11460 [Asparagus officinalis] Length = 167 Score = 77.8 bits (190), Expect = 2e-15 Identities = 33/42 (78%), Positives = 41/42 (97%) Frame = +2 Query: 275 KPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 KPIA+R+KKEAGRHP+FR+ I+++AQANHRITTT+QRRIYGH Sbjct: 18 KPIASRLKKEAGRHPRFRNFIVNIAQANHRITTTIQRRIYGH 59 >ref|XP_019235717.1| PREDICTED: optic atrophy 3 protein homolog [Nicotiana attenuata] Length = 169 Score = 77.4 bits (189), Expect = 4e-15 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA+R+K++AG HPKFR+ I+S+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIASRLKQQAGLHPKFRNFIVSIAQANHRVTTTMQRRIYGH 59 >ref|XP_009776510.1| PREDICTED: OPA3-like protein [Nicotiana sylvestris] ref|XP_016491041.1| PREDICTED: OPA3-like protein [Nicotiana tabacum] Length = 169 Score = 77.4 bits (189), Expect = 4e-15 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA+R+K++AG HPKFR+ I+S+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIASRLKQQAGLHPKFRNFIVSIAQANHRVTTTMQRRIYGH 59 >ref|XP_009589158.1| PREDICTED: optic atrophy 3 protein homolog [Nicotiana tomentosiformis] ref|XP_016444276.1| PREDICTED: optic atrophy 3 protein homolog [Nicotiana tabacum] Length = 169 Score = 77.4 bits (189), Expect = 4e-15 Identities = 33/43 (76%), Positives = 41/43 (95%) Frame = +2 Query: 272 SKPIAARIKKEAGRHPKFRSLIISVAQANHRITTTMQRRIYGH 400 SKPIA+R+K++AG HPKFR+ I+S+AQANHR+TTTMQRRIYGH Sbjct: 17 SKPIASRLKQQAGLHPKFRNFIVSIAQANHRVTTTMQRRIYGH 59