BLASTX nr result
ID: Rehmannia29_contig00011956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00011956 (528 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV56018.1| hypothetical protein F511_12717 [Dorcoceras hygro... 57 5e-14 ref|XP_020247843.1| F-box/LRR-repeat protein 20-like [Asparagus ... 59 5e-07 gb|KYP63307.1| Retrovirus-related Pol polyprotein from transposo... 47 7e-06 >gb|KZV56018.1| hypothetical protein F511_12717 [Dorcoceras hygrometricum] Length = 313 Score = 56.6 bits (135), Expect(2) = 5e-14 Identities = 24/32 (75%), Positives = 30/32 (93%) Frame = +1 Query: 1 DRTKHIDVRFHYIRDVVAKGIVCLEKILSEFN 96 DRTKHIDVRFH+IRD+V+KG++ LEKI SE+N Sbjct: 255 DRTKHIDVRFHFIRDIVSKGLIFLEKIPSEYN 286 Score = 48.5 bits (114), Expect(2) = 5e-14 Identities = 21/27 (77%), Positives = 22/27 (81%) Frame = +3 Query: 96 PVDMGAKCLPSSKFLSCLKILNFDTDD 176 P DMG KCLP SKF+SCLKIL FDT D Sbjct: 287 PADMGTKCLPVSKFMSCLKILKFDTCD 313 >ref|XP_020247843.1| F-box/LRR-repeat protein 20-like [Asparagus officinalis] Length = 602 Score = 59.3 bits (142), Expect = 5e-07 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = +1 Query: 1 DRTKHIDVRFHYIRDVVAKGIVCLEKILSEFN 96 DRTKHIDVRFHYIRD+V KGIV LEKI SEFN Sbjct: 199 DRTKHIDVRFHYIRDIVEKGIVKLEKIPSEFN 230 >gb|KYP63307.1| Retrovirus-related Pol polyprotein from transposon TNT 1-94 [Cajanus cajan] Length = 322 Score = 46.6 bits (109), Expect(2) = 7e-06 Identities = 18/32 (56%), Positives = 27/32 (84%) Frame = +1 Query: 1 DRTKHIDVRFHYIRDVVAKGIVCLEKILSEFN 96 +RTKH+DV+FH++RDVVA +V +EK+ +E N Sbjct: 264 ERTKHVDVKFHFVRDVVASDVVKIEKVATEEN 295 Score = 30.8 bits (68), Expect(2) = 7e-06 Identities = 14/21 (66%), Positives = 16/21 (76%) Frame = +3 Query: 99 VDMGAKCLPSSKFLSCLKILN 161 VDM K LPS+KF CLK+LN Sbjct: 297 VDMLTKALPSNKFEFCLKLLN 317