BLASTX nr result
ID: Rehmannia29_contig00011894
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00011894 (416 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN27087.1| ER vesicle integral membrane protein [Handroanthu... 110 3e-28 gb|KZV19435.1| protein cornichon4 [Dorcoceras hygrometricum] 109 5e-28 ref|XP_011081105.1| protein cornichon homolog 4 [Sesamum indicum] 109 7e-28 ref|XP_022881165.1| protein cornichon homolog 4-like [Olea europ... 107 3e-27 ref|XP_012833635.1| PREDICTED: protein cornichon homolog 4-like ... 107 4e-27 ref|XP_022866798.1| protein cornichon homolog 4-like [Olea europ... 106 1e-26 ref|XP_012845697.1| PREDICTED: protein cornichon homolog 4-like ... 103 2e-25 gb|PHU14641.1| Protein cornichon -like protein 4 [Capsicum chine... 101 1e-24 ref|XP_004242012.1| PREDICTED: protein cornichon homolog 4 [Sola... 101 1e-24 gb|PHT29909.1| Protein cornichon -like protein 4 [Capsicum bacca... 100 1e-24 ref|XP_016575131.1| PREDICTED: protein cornichon homolog 4 [Caps... 100 1e-24 ref|XP_006363909.1| PREDICTED: protein cornichon homolog 4 [Sola... 100 1e-24 ref|XP_004147951.1| PREDICTED: protein cornichon homolog 4 [Cucu... 100 3e-24 ref|XP_022873865.1| protein cornichon homolog 4-like [Olea europ... 100 4e-24 gb|PIN02844.1| ER vesicle integral membrane protein [Handroanthu... 99 6e-24 ref|XP_016900572.1| PREDICTED: probable protein cornichon homolo... 98 8e-24 gb|KVH90036.1| Cornichon [Cynara cardunculus var. scolymus] 99 1e-23 ref|XP_008448916.1| PREDICTED: protein cornichon homolog 4 isofo... 98 1e-23 ref|XP_021972499.1| protein cornichon homolog 4-like [Helianthus... 98 2e-23 ref|XP_023539252.1| protein cornichon homolog 4-like [Cucurbita ... 98 2e-23 >gb|PIN27087.1| ER vesicle integral membrane protein [Handroanthus impetiginosus] Length = 136 Score = 110 bits (274), Expect = 3e-28 Identities = 49/54 (90%), Positives = 54/54 (100%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+R+HL+DVTEIFNLLNWEKKQRLFKLGYI+LLLFMCLFW+IYNALEDDE Sbjct: 83 VRLYLRREHLIDVTEIFNLLNWEKKQRLFKLGYIILLLFMCLFWLIYNALEDDE 136 >gb|KZV19435.1| protein cornichon4 [Dorcoceras hygrometricum] Length = 139 Score = 109 bits (273), Expect = 5e-28 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+RQHLVDVTEIFNLL+WEKKQRLFKLGYI+LLLFMCLFWMIYNALEDD+ Sbjct: 83 VRLYLRRQHLVDVTEIFNLLSWEKKQRLFKLGYIILLLFMCLFWMIYNALEDDD 136 >ref|XP_011081105.1| protein cornichon homolog 4 [Sesamum indicum] Length = 139 Score = 109 bits (272), Expect = 7e-28 Identities = 49/54 (90%), Positives = 54/54 (100%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+RQHL+DVTEIFNLLNWEKKQRLFKLGYI+LLLFMCLFWMI+NALE+DE Sbjct: 83 VRLYLRRQHLIDVTEIFNLLNWEKKQRLFKLGYIILLLFMCLFWMIFNALEEDE 136 >ref|XP_022881165.1| protein cornichon homolog 4-like [Olea europaea var. sylvestris] Length = 139 Score = 107 bits (268), Expect = 3e-27 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLY++RQHLVDVTEIFNLLNWEKKQRLFKLGY++LLLFM LFWMIYNALEDDE Sbjct: 83 VRLYMRRQHLVDVTEIFNLLNWEKKQRLFKLGYVILLLFMSLFWMIYNALEDDE 136 >ref|XP_012833635.1| PREDICTED: protein cornichon homolog 4-like [Erythranthe guttata] gb|EYU40573.1| hypothetical protein MIMGU_mgv1a016042mg [Erythranthe guttata] Length = 136 Score = 107 bits (267), Expect = 4e-27 Identities = 48/54 (88%), Positives = 53/54 (98%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 V LYL+++HLVDVTEIFNLLNWEKKQRLFKLGY++LLLFMCLFWMIYNALEDDE Sbjct: 83 VMLYLKKKHLVDVTEIFNLLNWEKKQRLFKLGYVILLLFMCLFWMIYNALEDDE 136 >ref|XP_022866798.1| protein cornichon homolog 4-like [Olea europaea var. sylvestris] Length = 139 Score = 106 bits (264), Expect = 1e-26 Identities = 47/54 (87%), Positives = 52/54 (96%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLY +RQHLVDVTEIFNLLNWEKKQRLFKLGY++L LFMCLFWMIYNALE+D+ Sbjct: 83 VRLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYVILFLFMCLFWMIYNALEEDD 136 >ref|XP_012845697.1| PREDICTED: protein cornichon homolog 4-like [Erythranthe guttata] gb|EYU30463.1| hypothetical protein MIMGU_mgv1a015975mg [Erythranthe guttata] Length = 139 Score = 103 bits (256), Expect = 2e-25 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+R+HL+DVTEIFN+LNWEKKQRLFKLGY +LL+FMCLFWMIY ALE+DE Sbjct: 83 VRLYLRREHLMDVTEIFNMLNWEKKQRLFKLGYTILLIFMCLFWMIYKALEEDE 136 >gb|PHU14641.1| Protein cornichon -like protein 4 [Capsicum chinense] Length = 139 Score = 101 bits (251), Expect = 1e-24 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 412 RLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 RLY +RQHLVDVTEIFNLLNWEKKQRLFKLGYI+LLLF+ LFW+IY+ALEDDE Sbjct: 84 RLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYIILLLFLSLFWLIYSALEDDE 136 >ref|XP_004242012.1| PREDICTED: protein cornichon homolog 4 [Solanum lycopersicum] ref|XP_015077568.1| PREDICTED: protein cornichon homolog 4 [Solanum pennellii] Length = 139 Score = 101 bits (251), Expect = 1e-24 Identities = 47/53 (88%), Positives = 51/53 (96%) Frame = -2 Query: 412 RLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 RLY +RQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLF+ LFW+IY+ALEDDE Sbjct: 84 RLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFISLFWLIYSALEDDE 136 >gb|PHT29909.1| Protein cornichon -like protein 4 [Capsicum baccatum] Length = 139 Score = 100 bits (250), Expect = 1e-24 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 412 RLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 RLY +RQHLVDVTEIFNLLNWEKKQRLFKLGYI+LLLF+ LFW+IY+ALEDDE Sbjct: 84 RLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYIILLLFVSLFWLIYSALEDDE 136 >ref|XP_016575131.1| PREDICTED: protein cornichon homolog 4 [Capsicum annuum] gb|PHT78863.1| Protein cornichon -like protein 4 [Capsicum annuum] Length = 139 Score = 100 bits (250), Expect = 1e-24 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 412 RLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 RLY +RQHLVDVTEIFNLLNWEKKQRLFKLGYI+LLLF+ LFW+IY+ALEDDE Sbjct: 84 RLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYIILLLFVSLFWLIYSALEDDE 136 >ref|XP_006363909.1| PREDICTED: protein cornichon homolog 4 [Solanum tuberosum] Length = 139 Score = 100 bits (250), Expect = 1e-24 Identities = 46/53 (86%), Positives = 51/53 (96%) Frame = -2 Query: 412 RLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 RLY +RQHLVDVTEIFNLLNWEKKQRLFKLGYI+LLLF+ LFW+IY+ALEDDE Sbjct: 84 RLYTRRQHLVDVTEIFNLLNWEKKQRLFKLGYIILLLFISLFWLIYSALEDDE 136 >ref|XP_004147951.1| PREDICTED: protein cornichon homolog 4 [Cucumis sativus] ref|XP_011650427.1| PREDICTED: protein cornichon homolog 4 [Cucumis sativus] gb|KGN55923.1| hypothetical protein Csa_3G036490 [Cucumis sativus] Length = 136 Score = 100 bits (248), Expect = 3e-24 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+RQHL+DVTEIFN+LNWEKKQRLFKL Y+V+LLF+ +FWMIY+ALEDDE Sbjct: 83 VRLYLRRQHLIDVTEIFNMLNWEKKQRLFKLAYLVVLLFLSIFWMIYHALEDDE 136 >ref|XP_022873865.1| protein cornichon homolog 4-like [Olea europaea var. sylvestris] Length = 136 Score = 99.8 bits (247), Expect = 4e-24 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLY++RQHLVDVTEIFNLL+WEKKQR+ KLGYIV+LLF+ LFWMIYNALEDD+ Sbjct: 83 VRLYMRRQHLVDVTEIFNLLSWEKKQRIIKLGYIVVLLFISLFWMIYNALEDDD 136 >gb|PIN02844.1| ER vesicle integral membrane protein [Handroanthus impetiginosus] Length = 114 Score = 98.6 bits (244), Expect = 6e-24 Identities = 47/54 (87%), Positives = 49/54 (90%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLY RQHLVDVTEIFN LNWEKKQRLFKLGYIVLLLFM LFWMIY AL++DE Sbjct: 58 VRLYQGRQHLVDVTEIFNQLNWEKKQRLFKLGYIVLLLFMSLFWMIYTALDEDE 111 >ref|XP_016900572.1| PREDICTED: probable protein cornichon homolog 2 isoform X2 [Cucumis melo] Length = 112 Score = 98.2 bits (243), Expect = 8e-24 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+RQ+LVDVTEIFN+LNWEKKQRLFKL Y+V+LLF+ +FWMIY+ALEDDE Sbjct: 59 VRLYLRRQYLVDVTEIFNMLNWEKKQRLFKLAYLVVLLFLSIFWMIYHALEDDE 112 >gb|KVH90036.1| Cornichon [Cynara cardunculus var. scolymus] Length = 137 Score = 98.6 bits (244), Expect = 1e-23 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLY ++QHLVDVTEIFN LNWEKKQRLFKLGY++ LLF+ LFWMIYNAL+DDE Sbjct: 83 VRLYTRKQHLVDVTEIFNQLNWEKKQRLFKLGYLIFLLFITLFWMIYNALDDDE 136 >ref|XP_008448916.1| PREDICTED: protein cornichon homolog 4 isoform X1 [Cucumis melo] ref|XP_008448917.1| PREDICTED: protein cornichon homolog 4 isoform X1 [Cucumis melo] Length = 136 Score = 98.2 bits (243), Expect = 1e-23 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VRLYL+RQ+LVDVTEIFN+LNWEKKQRLFKL Y+V+LLF+ +FWMIY+ALEDDE Sbjct: 83 VRLYLRRQYLVDVTEIFNMLNWEKKQRLFKLAYLVVLLFLSIFWMIYHALEDDE 136 >ref|XP_021972499.1| protein cornichon homolog 4-like [Helianthus annuus] gb|OTG20042.1| putative cornichon family protein [Helianthus annuus] Length = 137 Score = 98.2 bits (243), Expect = 2e-23 Identities = 44/53 (83%), Positives = 49/53 (92%) Frame = -2 Query: 412 RLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 RLY ++QHLVDVTEIFN LNWEKKQRLFKLGY++ LLF+ LFWMIYNALEDDE Sbjct: 84 RLYTRKQHLVDVTEIFNQLNWEKKQRLFKLGYLIFLLFITLFWMIYNALEDDE 136 >ref|XP_023539252.1| protein cornichon homolog 4-like [Cucurbita pepo subsp. pepo] Length = 136 Score = 97.8 bits (242), Expect = 2e-23 Identities = 44/54 (81%), Positives = 50/54 (92%) Frame = -2 Query: 415 VRLYLQRQHLVDVTEIFNLLNWEKKQRLFKLGYIVLLLFMCLFWMIYNALEDDE 254 VR+YL+RQHLVDVTEIFN+LNWEKKQRLFKL Y+V LLF+ +FWMIY ALEDDE Sbjct: 83 VRMYLRRQHLVDVTEIFNMLNWEKKQRLFKLAYLVFLLFLSVFWMIYYALEDDE 136