BLASTX nr result
ID: Rehmannia29_contig00011792
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00011792 (513 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26931.1| hypothetical protein CDL12_00288 [Handroanthus im... 57 9e-08 gb|EYU21438.1| hypothetical protein MIMGU_mgv1a017424mg [Erythra... 57 1e-07 >gb|PIN26931.1| hypothetical protein CDL12_00288 [Handroanthus impetiginosus] Length = 78 Score = 57.0 bits (136), Expect = 9e-08 Identities = 28/39 (71%), Positives = 32/39 (82%) Frame = -1 Query: 432 MASKNLRSIMVTLFLLAFVLSPILPTGDAARVTIVQDVL 316 MA+ +LRSI V LFL FVL PILPTGDAAR T+VQ+VL Sbjct: 1 MAANSLRSITVALFLFVFVLYPILPTGDAARATVVQEVL 39 >gb|EYU21438.1| hypothetical protein MIMGU_mgv1a017424mg [Erythranthe guttata] Length = 76 Score = 56.6 bits (135), Expect = 1e-07 Identities = 27/39 (69%), Positives = 33/39 (84%) Frame = -1 Query: 432 MASKNLRSIMVTLFLLAFVLSPILPTGDAARVTIVQDVL 316 MAS N+ S+MVT+ + FVLSP+L TGDAARVTIVQ+VL Sbjct: 1 MASNNVNSVMVTILVFVFVLSPMLSTGDAARVTIVQEVL 39