BLASTX nr result
ID: Rehmannia29_contig00010924
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00010924 (385 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094082.1| putative inactive cadmium/zinc-transporting ... 72 6e-12 >ref|XP_011094082.1| putative inactive cadmium/zinc-transporting ATPase HMA3 [Sesamum indicum] Length = 929 Score = 71.6 bits (174), Expect = 6e-12 Identities = 38/88 (43%), Positives = 46/88 (52%), Gaps = 23/88 (26%) Frame = -1 Query: 199 HNHGCSENSSSCKSIATE--------NGPHETIQKQKCEHGNQS-----DEQVMHKHHCM 59 HNHGC + S CK + N HET++KQKCEH S D+QVMH +HCM Sbjct: 823 HNHGCPKKESCCKKNSCSKSAQRHKHNRLHETVEKQKCEHKGSSQSPISDKQVMHNNHCM 882 Query: 58 ENHCVN----------PGKDDSPRKECC 5 ENHC N G +S R+ECC Sbjct: 883 ENHCANHDDKLKGRTLHGCCNSLRRECC 910