BLASTX nr result
ID: Rehmannia29_contig00010864
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00010864 (428 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU34759.1| hypothetical protein MIMGU_mgv1a016066mg [Erythra... 53 5e-06 >gb|EYU34759.1| hypothetical protein MIMGU_mgv1a016066mg [Erythranthe guttata] Length = 135 Score = 53.1 bits (126), Expect = 5e-06 Identities = 26/42 (61%), Positives = 33/42 (78%), Gaps = 2/42 (4%) Frame = -1 Query: 422 YPSFSFGFFLNPISPTSLIR--SEPNDEMAPEESNIIRADSV 303 YP+FSF FFLNP SP+SL R EP++E ++SN+IRADSV Sbjct: 70 YPTFSFEFFLNPNSPSSLFRPEPEPDEETDADDSNVIRADSV 111