BLASTX nr result
ID: Rehmannia29_contig00010809
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00010809 (481 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012850311.1| PREDICTED: uncharacterized protein LOC105970... 55 8e-06 >ref|XP_012850311.1| PREDICTED: uncharacterized protein LOC105970075 [Erythranthe guttata] gb|EYU26528.1| hypothetical protein MIMGU_mgv1a007218mg [Erythranthe guttata] Length = 414 Score = 55.1 bits (131), Expect = 8e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 479 SEGDSVIVGDSIVGTLVEVPFLRDQLPPSK 390 SEGDSV VGD++VGTLVE+PFLRDQ PPSK Sbjct: 384 SEGDSVTVGDNVVGTLVELPFLRDQRPPSK 413