BLASTX nr result
ID: Rehmannia29_contig00010734
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00010734 (666 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN16789.1| hypothetical protein CDL12_10560 [Handroanthus im... 84 3e-15 ref|XP_011080873.1| ethylene-responsive transcription factor CRF... 75 3e-12 ref|XP_012854331.1| PREDICTED: ethylene-responsive transcription... 67 3e-09 gb|PIN23628.1| hypothetical protein CDL12_03659 [Handroanthus im... 63 4e-08 ref|XP_012834244.1| PREDICTED: ethylene-responsive transcription... 62 8e-08 >gb|PIN16789.1| hypothetical protein CDL12_10560 [Handroanthus impetiginosus] Length = 357 Score = 83.6 bits (205), Expect = 3e-15 Identities = 39/47 (82%), Positives = 42/47 (89%) Frame = +2 Query: 479 EEKTMVSGRRVKYSEHINQTTVVSRPEYPISGRKNHFPAEMTTRTVR 619 EEKTM+SG+RVKYSEHI QTTVV RPE+P SGRKNHFP E TTRTVR Sbjct: 6 EEKTMLSGKRVKYSEHITQTTVVRRPEHPTSGRKNHFPEENTTRTVR 52 >ref|XP_011080873.1| ethylene-responsive transcription factor CRF2 [Sesamum indicum] Length = 356 Score = 75.1 bits (183), Expect = 3e-12 Identities = 36/50 (72%), Positives = 44/50 (88%), Gaps = 3/50 (6%) Frame = +2 Query: 479 EEKTMVSGRR---VKYSEHINQTTVVSRPEYPISGRKNHFPAEMTTRTVR 619 EE+TM+SG R +KY+EH+NQTTVVSR +YPISGR++ FPAEMTTRTVR Sbjct: 8 EEETMLSGARRGRIKYTEHVNQTTVVSRSDYPISGRRSPFPAEMTTRTVR 57 >ref|XP_012854331.1| PREDICTED: ethylene-responsive transcription factor CRF1 [Erythranthe guttata] gb|EYU23389.1| hypothetical protein MIMGU_mgv1a023604mg [Erythranthe guttata] Length = 346 Score = 66.6 bits (161), Expect = 3e-09 Identities = 30/43 (69%), Positives = 37/43 (86%) Frame = +2 Query: 491 MVSGRRVKYSEHINQTTVVSRPEYPISGRKNHFPAEMTTRTVR 619 M+SG RVKY+EH++ TTVV+RPEY ISGRK+ FPAE+ RTVR Sbjct: 1 MLSGTRVKYTEHVSHTTVVARPEYSISGRKSFFPAEIPARTVR 43 >gb|PIN23628.1| hypothetical protein CDL12_03659 [Handroanthus impetiginosus] Length = 326 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = +2 Query: 491 MVSGRRVKYSEHINQTTVVSRPEYPISGRKNHFPAEMTTRTVR 619 M+SG VKY+EH+N+TTV+ RPEY +SG + FPA MTTRTVR Sbjct: 1 MMSGSNVKYTEHLNKTTVICRPEYSLSGGEKLFPARMTTRTVR 43 >ref|XP_012834244.1| PREDICTED: ethylene-responsive transcription factor CRF2-like [Erythranthe guttata] gb|EYU40041.1| hypothetical protein MIMGU_mgv1a019113mg [Erythranthe guttata] Length = 340 Score = 62.4 bits (150), Expect = 8e-08 Identities = 29/47 (61%), Positives = 36/47 (76%) Frame = +2 Query: 479 EEKTMVSGRRVKYSEHINQTTVVSRPEYPISGRKNHFPAEMTTRTVR 619 EE+TM+SG+ VKYSEH++QTT V PEY +SG + FPA M RTVR Sbjct: 5 EEQTMLSGKLVKYSEHLSQTTTVIMPEYSVSGGRRTFPAGMAGRTVR 51