BLASTX nr result
ID: Rehmannia29_contig00010503
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00010503 (433 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011099788.1| acetylglutamate kinase, chloroplastic [Sesam... 73 2e-12 >ref|XP_011099788.1| acetylglutamate kinase, chloroplastic [Sesamum indicum] ref|XP_011099791.1| acetylglutamate kinase, chloroplastic [Sesamum indicum] ref|XP_020554769.1| acetylglutamate kinase, chloroplastic [Sesamum indicum] Length = 345 Score = 73.2 bits (178), Expect = 2e-12 Identities = 36/52 (69%), Positives = 42/52 (80%) Frame = -2 Query: 156 MLAAKILPFTSPHSKLLVKSNDFAPSFQNTVPVVKFKRNSKITCLKSSLQSI 1 MLAAK LP TSPHS L+ KSN FA S + TVP +KFKR+SK TC+KSSLQS+ Sbjct: 1 MLAAKTLPLTSPHSTLIEKSNGFALSSRTTVPFLKFKRSSKTTCIKSSLQSV 52