BLASTX nr result
ID: Rehmannia29_contig00010090
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00010090 (437 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN02468.1| hypothetical protein CDL12_25014 [Handroanthus im... 69 3e-11 gb|PIN08886.1| hypothetical protein CDL12_18540 [Handroanthus im... 67 2e-10 ref|XP_012854971.1| PREDICTED: uncharacterized protein LOC105974... 56 3e-06 >gb|PIN02468.1| hypothetical protein CDL12_25014 [Handroanthus impetiginosus] Length = 287 Score = 69.3 bits (168), Expect = 3e-11 Identities = 43/88 (48%), Positives = 52/88 (59%), Gaps = 3/88 (3%) Frame = +3 Query: 147 SASG---LLSLKRLPLASSRALGPNLTSVFPANNQGPFLSRAQIKHSSPKPRLVRGXXXX 317 +ASG LLSLKRLPLASS +GPN +S F AN Q P +K+SS + RL+ G Sbjct: 21 AASGCTCLLSLKRLPLASSGTIGPNFSSFFSANKQAPIFPINHLKNSSSRFRLIAG---A 77 Query: 318 XXXXXXXXXXXDKPTVPDNEFTLAKVSF 401 DK VPD+EF+LAKVSF Sbjct: 78 AESTPPSSVAADKSIVPDDEFSLAKVSF 105 >gb|PIN08886.1| hypothetical protein CDL12_18540 [Handroanthus impetiginosus] Length = 287 Score = 67.0 bits (162), Expect = 2e-10 Identities = 40/83 (48%), Positives = 47/83 (56%) Frame = +3 Query: 153 SGLLSLKRLPLASSRALGPNLTSVFPANNQGPFLSRAQIKHSSPKPRLVRGXXXXXXXXX 332 + LLSLKRLP ASS +GPN S F ANN+ P +K+SS + RLV G Sbjct: 26 TSLLSLKRLPSASSGTIGPNFPSFFSANNRAPIFPINHLKNSSSRFRLVAG---AAESTP 82 Query: 333 XXXXXXDKPTVPDNEFTLAKVSF 401 DK VPD EF+LAKVSF Sbjct: 83 PSSVAADKSIVPDEEFSLAKVSF 105 >ref|XP_012854971.1| PREDICTED: uncharacterized protein LOC105974414 [Erythranthe guttata] gb|EYU44653.1| hypothetical protein MIMGU_mgv1a011155mg [Erythranthe guttata] Length = 290 Score = 55.8 bits (133), Expect = 3e-06 Identities = 41/97 (42%), Positives = 49/97 (50%), Gaps = 4/97 (4%) Frame = +3 Query: 123 IIHRFPGFSASG---LLSLKRLPLASSRALGPNLTSVFPANNQGPFLSRAQIKHSSPK-P 290 ++ R P SASG +LSLKR LAS + PN + F N P L +K+ K Sbjct: 12 LVLRSPFSSASGCTCILSLKRHSLASLGSRRPNSCTNFAPNRHAPCLPITHLKNRIHKLS 71 Query: 291 RLVRGXXXXXXXXXXXXXXXDKPTVPDNEFTLAKVSF 401 RLV DKPTVPDNEF+LAKVSF Sbjct: 72 RLVPRAAESTQPSSIAATSADKPTVPDNEFSLAKVSF 108