BLASTX nr result
ID: Rehmannia29_contig00009654
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00009654 (621 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012836101.1| PREDICTED: UPF0481 protein At3g47200 [Erythr... 59 2e-06 gb|PIN16817.1| hypothetical protein CDL12_10519 [Handroanthus im... 57 7e-06 >ref|XP_012836101.1| PREDICTED: UPF0481 protein At3g47200 [Erythranthe guttata] gb|EYU38618.1| hypothetical protein MIMGU_mgv1a006266mg [Erythranthe guttata] Length = 450 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = -1 Query: 621 WSFISAMAAFVLLVLTVAQTYFTIIGYVRPA 529 WSFISA+AA VLL+LTVAQTYFTI+GYVRPA Sbjct: 419 WSFISALAALVLLLLTVAQTYFTILGYVRPA 449 >gb|PIN16817.1| hypothetical protein CDL12_10519 [Handroanthus impetiginosus] Length = 449 Score = 56.6 bits (135), Expect = 7e-06 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -1 Query: 621 WSFISAMAAFVLLVLTVAQTYFTIIGYVRP 532 WSFISA+AAFVLLVLTVAQT+FTI+ YVRP Sbjct: 419 WSFISALAAFVLLVLTVAQTFFTILAYVRP 448