BLASTX nr result
ID: Rehmannia29_contig00009502
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00009502 (505 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012840776.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 73 6e-12 gb|KZV24818.1| glyoxysomal fatty acid beta-oxidation multifuncti... 73 9e-12 ref|XP_016506757.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 67 3e-11 ref|XP_011071437.1| glyoxysomal fatty acid beta-oxidation multif... 71 4e-11 gb|PIN12055.1| Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase... 70 7e-11 gb|PHT33187.1| Glyoxysomal fatty acid beta-oxidation multifuncti... 69 3e-10 dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation m... 69 3e-10 ref|XP_016550654.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 69 3e-10 ref|XP_016550653.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 69 3e-10 ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 67 1e-09 ref|XP_022878758.1| glyoxysomal fatty acid beta-oxidation multif... 66 2e-09 ref|XP_022850927.1| glyoxysomal fatty acid beta-oxidation multif... 65 3e-09 ref|XP_016508177.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ... 65 3e-09 ref|XP_022850926.1| glyoxysomal fatty acid beta-oxidation multif... 65 3e-09 ref|XP_019263551.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 65 3e-09 ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 65 3e-09 ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 62 3e-08 gb|KZM85519.1| hypothetical protein DCAR_027059 [Daucus carota s... 62 5e-08 ref|XP_017222695.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 62 5e-08 ref|XP_023914960.1| glyoxysomal fatty acid beta-oxidation multif... 61 9e-08 >ref|XP_012840776.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Erythranthe guttata] gb|EYU45545.1| hypothetical protein MIMGU_mgv1a002038mg [Erythranthe guttata] Length = 724 Score = 73.2 bits (178), Expect = 6e-12 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPCSYLAERAAKGAPLSLTVDP KS Sbjct: 688 EWSNLYGGFFKPCSYLAERAAKGAPLSLTVDPTKS 722 >gb|KZV24818.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Dorcoceras hygrometricum] Length = 748 Score = 72.8 bits (177), Expect = 9e-12 Identities = 33/35 (94%), Positives = 33/35 (94%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPCSYLA RAAKGAPLSLTVDPAKS Sbjct: 712 EWSNKYGGFFKPCSYLAGRAAKGAPLSLTVDPAKS 746 >ref|XP_016506757.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Nicotiana tabacum] Length = 96 Score = 66.6 bits (161), Expect = 3e-11 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLS T+DPAKS Sbjct: 60 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPAKS 94 >ref|XP_011071437.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Sesamum indicum] Length = 724 Score = 70.9 bits (172), Expect = 4e-11 Identities = 32/35 (91%), Positives = 32/35 (91%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS SYGGFFKPCSYLAERAAKGAPLSL DPAKS Sbjct: 688 EWSKSYGGFFKPCSYLAERAAKGAPLSLMTDPAKS 722 >gb|PIN12055.1| Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Handroanthus impetiginosus] Length = 724 Score = 70.1 bits (170), Expect = 7e-11 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS SYGGFFKPCSYLA+RAAKGAPLSLT+D AKS Sbjct: 688 EWSKSYGGFFKPCSYLADRAAKGAPLSLTIDTAKS 722 >gb|PHT33187.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Capsicum baccatum] Length = 725 Score = 68.6 bits (166), Expect = 3e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKS Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKS 723 >dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation multifunctional protein [Capsicum chinense] gb|PHU01746.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Capsicum chinense] Length = 725 Score = 68.6 bits (166), Expect = 3e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKS Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKS 723 >ref|XP_016550654.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a isoform X2 [Capsicum annuum] gb|PHT66951.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Capsicum annuum] Length = 725 Score = 68.6 bits (166), Expect = 3e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKS Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKS 723 >ref|XP_016550653.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a isoform X1 [Capsicum annuum] Length = 727 Score = 68.6 bits (166), Expect = 3e-10 Identities = 31/35 (88%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKS Sbjct: 691 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKS 725 >ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Nicotiana tomentosiformis] Length = 725 Score = 66.6 bits (161), Expect = 1e-09 Identities = 30/35 (85%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLS T+DPAKS Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPAKS 723 >ref|XP_022878758.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Olea europaea var. sylvestris] Length = 724 Score = 66.2 bits (160), Expect = 2e-09 Identities = 29/35 (82%), Positives = 33/35 (94%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPCSYLA++AAKGAPLSL+VD AK+ Sbjct: 688 EWSNLYGGFFKPCSYLAQQAAKGAPLSLSVDQAKA 722 >ref|XP_022850927.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like isoform X2 [Olea europaea var. sylvestris] Length = 680 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPCSYLA+RAAKGA LS +VDPAK+ Sbjct: 644 EWSNLYGGFFKPCSYLAQRAAKGATLSSSVDPAKA 678 >ref|XP_016508177.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Nicotiana tabacum] Length = 702 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLS T+DP+KS Sbjct: 666 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPSKS 700 >ref|XP_022850926.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like isoform X1 [Olea europaea var. sylvestris] Length = 724 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPCSYLA+RAAKGA LS +VDPAK+ Sbjct: 688 EWSNLYGGFFKPCSYLAQRAAKGATLSSSVDPAKA 722 >ref|XP_019263551.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Nicotiana attenuata] gb|OIT37053.1| glyoxysomal fatty acid beta-oxidation multifunctional protein mfp-a [Nicotiana attenuata] Length = 725 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLS T+DP+KS Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPSKS 723 >ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Nicotiana sylvestris] Length = 725 Score = 65.5 bits (158), Expect = 3e-09 Identities = 29/35 (82%), Positives = 31/35 (88%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERAAKGAPLS T+DP+KS Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPSKS 723 >ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Solanum tuberosum] Length = 727 Score = 62.4 bits (150), Expect = 3e-08 Identities = 28/35 (80%), Positives = 29/35 (82%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWS YG FFKPCSYLAERA+KGAPLS T D AKS Sbjct: 691 EWSRMYGDFFKPCSYLAERASKGAPLSATTDSAKS 725 >gb|KZM85519.1| hypothetical protein DCAR_027059 [Daucus carota subsp. sativus] Length = 711 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPC+YLAE+AAKGAPLS +D K+ Sbjct: 675 EWSNKYGGFFKPCAYLAEKAAKGAPLSTPLDQGKA 709 >ref|XP_017222695.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Daucus carota subsp. sativus] Length = 720 Score = 62.0 bits (149), Expect = 5e-08 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSN YGGFFKPC+YLAE+AAKGAPLS +D K+ Sbjct: 684 EWSNKYGGFFKPCAYLAEKAAKGAPLSTPLDQGKA 718 >ref|XP_023914960.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Quercus suber] gb|POF07462.1| glyoxysomal fatty acid beta-oxidation multifunctional protein mfp-a [Quercus suber] Length = 726 Score = 61.2 bits (147), Expect = 9e-08 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 505 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKS 401 EWSNSYG FFKPC+YLAERA+KGAPLS V AKS Sbjct: 690 EWSNSYGEFFKPCAYLAERASKGAPLSSPVGQAKS 724