BLASTX nr result
ID: Rehmannia29_contig00009235
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00009235 (895 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084243.1| glutathione synthetase, chloroplastic [Sesam... 87 3e-15 ref|XP_012837764.1| PREDICTED: glutathione synthetase, chloropla... 83 4e-14 gb|PIN26627.1| Glutathione synthetase [Handroanthus impetiginosus] 83 6e-14 gb|PIN14959.1| Glutathione synthetase [Handroanthus impetiginosus] 83 6e-14 ref|XP_022882187.1| glutathione synthetase, chloroplastic [Olea ... 82 8e-14 gb|KMT13561.1| hypothetical protein BVRB_4g083360 [Beta vulgaris... 81 2e-13 ref|XP_010674998.1| PREDICTED: glutathione synthetase, chloropla... 81 2e-13 ref|XP_021278111.1| glutathione synthetase, chloroplastic [Herra... 80 3e-13 gb|OTG11101.1| putative glutathione synthase, eukaryotic [Helian... 79 4e-13 ref|XP_022739963.1| glutathione synthetase, chloroplastic-like [... 80 6e-13 ref|XP_017971936.1| PREDICTED: glutathione synthetase, chloropla... 79 8e-13 gb|KZV46407.1| glutathione synthetase, chloroplastic [Dorcoceras... 79 8e-13 ref|XP_017971935.1| PREDICTED: glutathione synthetase, chloropla... 79 8e-13 ref|NP_001313214.1| glutathione synthetase, chloroplastic [Nicot... 79 8e-13 gb|EOX99917.1| Glutathione synthetase 2 isoform 2 [Theobroma cacao] 79 8e-13 gb|EOX99916.1| Glutathione synthetase 2 isoform 1 [Theobroma cacao] 79 8e-13 ref|XP_021772977.1| LOW QUALITY PROTEIN: glutathione synthetase,... 79 1e-12 ref|XP_021988512.1| glutathione synthetase, chloroplastic [Helia... 79 1e-12 gb|ONI04628.1| hypothetical protein PRUPE_6G331000 [Prunus persica] 78 1e-12 dbj|GAY63900.1| hypothetical protein CUMW_229350 [Citrus unshiu] 79 2e-12 >ref|XP_011084243.1| glutathione synthetase, chloroplastic [Sesamum indicum] Length = 539 Score = 86.7 bits (213), Expect = 3e-15 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES Sbjct: 306 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 347 >ref|XP_012837764.1| PREDICTED: glutathione synthetase, chloroplastic [Erythranthe guttata] gb|EYU37221.1| hypothetical protein MIMGU_mgv1a004133mg [Erythranthe guttata] Length = 543 Score = 83.2 bits (204), Expect = 4e-14 Identities = 39/42 (92%), Positives = 42/42 (100%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEID+QG+L+PDGTLVVDGEAVAVVYFRAGYAPTDYPSES Sbjct: 310 TLAEIDSQGKLMPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 351 >gb|PIN26627.1| Glutathione synthetase [Handroanthus impetiginosus] Length = 540 Score = 82.8 bits (203), Expect = 6e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEIDAQGE+LPDGTLVVDGEAVAVVYFRAGY P+DYPSES Sbjct: 307 TLAEIDAQGEILPDGTLVVDGEAVAVVYFRAGYTPSDYPSES 348 >gb|PIN14959.1| Glutathione synthetase [Handroanthus impetiginosus] Length = 540 Score = 82.8 bits (203), Expect = 6e-14 Identities = 39/42 (92%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEIDAQGE+LPDGTLVVDGEAVAVVYFRAGY P+DYPSES Sbjct: 307 TLAEIDAQGEILPDGTLVVDGEAVAVVYFRAGYTPSDYPSES 348 >ref|XP_022882187.1| glutathione synthetase, chloroplastic [Olea europaea var. sylvestris] Length = 548 Score = 82.4 bits (202), Expect = 8e-14 Identities = 40/42 (95%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEIDA GELLPDGTLVVDGEAVAVVYFRAGYAP+DYPSES Sbjct: 315 TLAEIDALGELLPDGTLVVDGEAVAVVYFRAGYAPSDYPSES 356 >gb|KMT13561.1| hypothetical protein BVRB_4g083360 [Beta vulgaris subsp. vulgaris] Length = 502 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSE 123 TLAEIDA+GELLPDGTLVV GEA+AVVYFRAGYAPTDYPSE Sbjct: 269 TLAEIDAEGELLPDGTLVVQGEAIAVVYFRAGYAPTDYPSE 309 >ref|XP_010674998.1| PREDICTED: glutathione synthetase, chloroplastic [Beta vulgaris subsp. vulgaris] Length = 553 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/41 (92%), Positives = 40/41 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSE 123 TLAEIDA+GELLPDGTLVV GEA+AVVYFRAGYAPTDYPSE Sbjct: 320 TLAEIDAEGELLPDGTLVVQGEAIAVVYFRAGYAPTDYPSE 360 >ref|XP_021278111.1| glutathione synthetase, chloroplastic [Herrania umbratica] Length = 552 Score = 80.5 bits (197), Expect = 3e-13 Identities = 37/46 (80%), Positives = 43/46 (93%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSESVTKS 138 TLAEID +G+LLPDGTL+VDG+A+AVVYFRAGYAPTDYPSES +S Sbjct: 319 TLAEIDREGQLLPDGTLLVDGQAIAVVYFRAGYAPTDYPSESEWRS 364 >gb|OTG11101.1| putative glutathione synthase, eukaryotic [Helianthus annuus] Length = 279 Score = 78.6 bits (192), Expect = 4e-13 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSESVTKS 138 TLAEIDAQG++L DGTLVVDGE VAVVYFRAGYAP DYPSES K+ Sbjct: 46 TLAEIDAQGKILSDGTLVVDGETVAVVYFRAGYAPNDYPSESEWKA 91 >ref|XP_022739963.1| glutathione synthetase, chloroplastic-like [Durio zibethinus] Length = 550 Score = 79.7 bits (195), Expect = 6e-13 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEID +G+LLPDGTL+VDG+AVAVVYFRAGYAPTDYPSES Sbjct: 317 TLAEIDREGKLLPDGTLLVDGQAVAVVYFRAGYAPTDYPSES 358 >ref|XP_017971936.1| PREDICTED: glutathione synthetase, chloroplastic isoform X2 [Theobroma cacao] Length = 483 Score = 79.3 bits (194), Expect = 8e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEID +G+LLPDGTL+VDG+A+AV+YFRAGYAPTDYPSES Sbjct: 250 TLAEIDREGQLLPDGTLLVDGQAIAVIYFRAGYAPTDYPSES 291 >gb|KZV46407.1| glutathione synthetase, chloroplastic [Dorcoceras hygrometricum] Length = 539 Score = 79.3 bits (194), Expect = 8e-13 Identities = 39/46 (84%), Positives = 42/46 (91%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSESVTKS 138 TLA+IDAQG+LL DGTLVVDGE VAVVYFRAGYAPTDYPSES K+ Sbjct: 306 TLADIDAQGKLLRDGTLVVDGEPVAVVYFRAGYAPTDYPSESEWKA 351 >ref|XP_017971935.1| PREDICTED: glutathione synthetase, chloroplastic isoform X1 [Theobroma cacao] Length = 552 Score = 79.3 bits (194), Expect = 8e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEID +G+LLPDGTL+VDG+A+AV+YFRAGYAPTDYPSES Sbjct: 319 TLAEIDREGQLLPDGTLLVDGQAIAVIYFRAGYAPTDYPSES 360 >ref|NP_001313214.1| glutathione synthetase, chloroplastic [Nicotiana tabacum] ref|XP_009773603.1| PREDICTED: glutathione synthetase, chloroplastic [Nicotiana sylvestris] gb|AIL30500.1| glutathione synthetase [Nicotiana tabacum] Length = 555 Score = 79.3 bits (194), Expect = 8e-13 Identities = 38/46 (82%), Positives = 42/46 (91%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSESVTKS 138 TLAEIDAQGELL DGTL+VDGEAVAV+YFRAGYAP+DY SES K+ Sbjct: 323 TLAEIDAQGELLEDGTLIVDGEAVAVIYFRAGYAPSDYHSESAWKA 368 >gb|EOX99917.1| Glutathione synthetase 2 isoform 2 [Theobroma cacao] Length = 557 Score = 79.3 bits (194), Expect = 8e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEID +G+LLPDGTL+VDG+A+AV+YFRAGYAPTDYPSES Sbjct: 319 TLAEIDREGQLLPDGTLLVDGQAIAVIYFRAGYAPTDYPSES 360 >gb|EOX99916.1| Glutathione synthetase 2 isoform 1 [Theobroma cacao] Length = 562 Score = 79.3 bits (194), Expect = 8e-13 Identities = 35/42 (83%), Positives = 41/42 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEID +G+LLPDGTL+VDG+A+AV+YFRAGYAPTDYPSES Sbjct: 331 TLAEIDREGQLLPDGTLLVDGQAIAVIYFRAGYAPTDYPSES 372 >ref|XP_021772977.1| LOW QUALITY PROTEIN: glutathione synthetase, chloroplastic [Chenopodium quinoa] Length = 557 Score = 79.0 bits (193), Expect = 1e-12 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSE 123 TLAEIDA+G+LLPDGTL V+GEAVAVVYFRAGYAPTDYPSE Sbjct: 324 TLAEIDAEGKLLPDGTLAVNGEAVAVVYFRAGYAPTDYPSE 364 >ref|XP_021988512.1| glutathione synthetase, chloroplastic [Helianthus annuus] Length = 479 Score = 78.6 bits (192), Expect = 1e-12 Identities = 38/46 (82%), Positives = 41/46 (89%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSESVTKS 138 TLAEIDAQG++L DGTLVVDGE VAVVYFRAGYAP DYPSES K+ Sbjct: 246 TLAEIDAQGKILSDGTLVVDGETVAVVYFRAGYAPNDYPSESEWKA 291 >gb|ONI04628.1| hypothetical protein PRUPE_6G331000 [Prunus persica] Length = 343 Score = 77.8 bits (190), Expect = 1e-12 Identities = 36/42 (85%), Positives = 39/42 (92%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEIDA+GELLPDGTLVV G+A+AVVYFRAGY P DYPSES Sbjct: 110 TLAEIDAEGELLPDGTLVVGGQAIAVVYFRAGYTPNDYPSES 151 >dbj|GAY63900.1| hypothetical protein CUMW_229350 [Citrus unshiu] Length = 551 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 1 TLAEIDAQGELLPDGTLVVDGEAVAVVYFRAGYAPTDYPSES 126 TLAEIDA+GELLPDGTL+V G+ +AVVYFRAGYAPTDYPSES Sbjct: 318 TLAEIDAEGELLPDGTLLVGGQVIAVVYFRAGYAPTDYPSES 359