BLASTX nr result
ID: Rehmannia29_contig00009207
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00009207 (635 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN07907.1| hypothetical protein CDL12_19518 [Handroanthus im... 73 7e-12 ref|XP_011087410.2| protein SRC2 homolog [Sesamum indicum] 72 3e-11 gb|PIN09272.1| hypothetical protein CDL12_18139 [Handroanthus im... 69 3e-10 gb|EYU20982.1| hypothetical protein MIMGU_mgv1a011603mg [Erythra... 67 1e-09 ref|XP_012857113.1| PREDICTED: wiskott-Aldrich syndrome protein ... 67 1e-09 ref|XP_022870080.1| protein SRC2 homolog [Olea europaea var. syl... 63 3e-08 gb|KZV15761.1| hypothetical protein F511_32814 [Dorcoceras hygro... 62 4e-08 ref|XP_022867057.1| protein SRC2 homolog [Olea europaea var. syl... 60 1e-07 gb|EPS59428.1| hypothetical protein M569_15381 [Genlisea aurea] 56 7e-06 >gb|PIN07907.1| hypothetical protein CDL12_19518 [Handroanthus impetiginosus] Length = 275 Score = 73.2 bits (178), Expect = 7e-12 Identities = 37/70 (52%), Positives = 43/70 (61%), Gaps = 1/70 (1%) Frame = +1 Query: 1 LYKPDSNEDRVVEYQIRTPSGKSKGSIKFSCRFGEKFT-HQVEEKKHXXXXXXXXXXXXX 177 L++PDSNEDRVVEYQI TPSGK KG++KFS FGEKFT Q E K+H Sbjct: 101 LFRPDSNEDRVVEYQIHTPSGKPKGTLKFSYHFGEKFTQQQAEAKRHVDQPVTAYPAAPY 160 Query: 178 XXXXHPGMAY 207 +PG Y Sbjct: 161 SSAPYPGNGY 170 >ref|XP_011087410.2| protein SRC2 homolog [Sesamum indicum] Length = 282 Score = 71.6 bits (174), Expect = 3e-11 Identities = 31/45 (68%), Positives = 39/45 (86%) Frame = +1 Query: 1 LYKPDSNEDRVVEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKK 135 LY+PD+ ED+VVEYQ+ T SGK KG++KFS RFGEKFTHQ+E K+ Sbjct: 101 LYQPDATEDKVVEYQVHTRSGKPKGTLKFSYRFGEKFTHQMEAKR 145 >gb|PIN09272.1| hypothetical protein CDL12_18139 [Handroanthus impetiginosus] Length = 309 Score = 68.9 bits (167), Expect = 3e-10 Identities = 33/47 (70%), Positives = 38/47 (80%), Gaps = 1/47 (2%) Frame = +1 Query: 1 LYKPDSNEDRVVEYQIRTPSGKSKGSIKFSCRFGEKFT-HQVEEKKH 138 L++PDSNEDRVVEYQI TPSG KG++KFS FGEKFT Q E K+H Sbjct: 101 LFRPDSNEDRVVEYQIHTPSGIPKGTLKFSYHFGEKFTQQQAEAKRH 147 >gb|EYU20982.1| hypothetical protein MIMGU_mgv1a011603mg [Erythranthe guttata] Length = 276 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +1 Query: 1 LYKPDSN--EDRVVEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKH 138 L+ PDS EDR VEYQ+ TPSGKSKGS+KFS +FGEKF +VE K+H Sbjct: 101 LFNPDSTTQEDRQVEYQLHTPSGKSKGSLKFSYQFGEKFKQEVEAKRH 148 >ref|XP_012857113.1| PREDICTED: wiskott-Aldrich syndrome protein family member 2-like [Erythranthe guttata] Length = 286 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 2/48 (4%) Frame = +1 Query: 1 LYKPDSN--EDRVVEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKH 138 L+ PDS EDR VEYQ+ TPSGKSKGS+KFS +FGEKF +VE K+H Sbjct: 101 LFNPDSTTQEDRQVEYQLHTPSGKSKGSLKFSYQFGEKFKQEVEAKRH 148 >ref|XP_022870080.1| protein SRC2 homolog [Olea europaea var. sylvestris] Length = 282 Score = 63.2 bits (152), Expect = 3e-08 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 22 EDRVVEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKH 138 E++V+EYQ+RT SGK KGSIKFS +FGEKF QVE KKH Sbjct: 111 EEKVIEYQVRTSSGKPKGSIKFSYKFGEKFAQQVETKKH 149 >gb|KZV15761.1| hypothetical protein F511_32814 [Dorcoceras hygrometricum] Length = 264 Score = 62.4 bits (150), Expect = 4e-08 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = +1 Query: 1 LYKPDSNEDRVVEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKH 138 LY+ + + D+VV+YQ+RT SGK +G++K S FGEKFTHQ E KKH Sbjct: 101 LYRSNPSGDKVVDYQVRTSSGKPRGTLKISYSFGEKFTHQPEAKKH 146 >ref|XP_022867057.1| protein SRC2 homolog [Olea europaea var. sylvestris] Length = 225 Score = 60.5 bits (145), Expect = 1e-07 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = +1 Query: 25 DRVVEYQIRTPSGKSKGSIKFSCRFGEKFTHQVEEKKH 138 +RVVEYQ+ T SGK KG IKFS +FGEKFT QVE KKH Sbjct: 112 ERVVEYQLTTSSGKPKGKIKFSYKFGEKFTQQVETKKH 149 >gb|EPS59428.1| hypothetical protein M569_15381 [Genlisea aurea] Length = 279 Score = 56.2 bits (134), Expect = 7e-06 Identities = 25/34 (73%), Positives = 30/34 (88%) Frame = +1 Query: 13 DSNEDRVVEYQIRTPSGKSKGSIKFSCRFGEKFT 114 DS+EDRVVEYQ+ T SGK KG++KFS RFGEKF+ Sbjct: 107 DSHEDRVVEYQVHTQSGKPKGTLKFSYRFGEKFS 140