BLASTX nr result
ID: Rehmannia29_contig00009088
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00009088 (442 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012834915.1| PREDICTED: chorismate synthase 1, chloroplas... 93 3e-19 ref|XP_011084359.1| chorismate synthase 1, chloroplastic [Sesamu... 92 6e-19 gb|PHU17069.1| Chorismate synthase, chloroplastic [Capsicum chin... 90 3e-18 gb|PHT80979.1| Chorismate synthase, chloroplastic [Capsicum annuum] 90 3e-18 ref|XP_016572296.1| PREDICTED: chorismate synthase 2, chloroplas... 90 3e-18 gb|PHT54236.1| Chorismate synthase, chloroplastic [Capsicum bacc... 89 7e-18 emb|CDP04364.1| unnamed protein product [Coffea canephora] 84 2e-17 ref|XP_022860610.1| chorismate synthase 1, chloroplastic-like is... 87 3e-17 ref|XP_022860466.1| chorismate synthase 1, chloroplastic-like is... 87 3e-17 ref|XP_022860408.1| chorismate synthase 1, chloroplastic-like is... 87 3e-17 ref|XP_006359349.1| PREDICTED: chorismate synthase 2, chloroplas... 87 4e-17 ref|XP_022860335.1| chorismate synthase 2, chloroplastic-like is... 87 4e-17 ref|XP_006359348.1| PREDICTED: chorismate synthase 2, chloroplas... 87 4e-17 dbj|BAD93818.1| hypothetical protein [Arabidopsis thaliana] 80 5e-17 gb|PIN09701.1| Chorismate synthase [Handroanthus impetiginosus] 82 2e-16 ref|XP_010670014.1| PREDICTED: chorismate synthase 1, chloroplas... 85 2e-16 ref|XP_022860923.1| chorismate synthase 1, chloroplastic-like [O... 85 2e-16 ref|XP_010461744.1| PREDICTED: chorismate synthase, chloroplasti... 79 3e-16 gb|OVA18093.1| Chorismate synthase [Macleaya cordata] 84 3e-16 ref|XP_021757384.1| chorismate synthase 1, chloroplastic-like [C... 84 5e-16 >ref|XP_012834915.1| PREDICTED: chorismate synthase 1, chloroplastic-like [Erythranthe guttata] gb|EYU39818.1| hypothetical protein MIMGU_mgv1a006605mg [Erythranthe guttata] Length = 437 Score = 92.8 bits (229), Expect = 3e-19 Identities = 46/52 (88%), Positives = 48/52 (92%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVL+DQLMAQYAQCMLFPINPALQEPLE+ NEQAQ L Sbjct: 386 VPRAVPMVEAMVALVLIDQLMAQYAQCMLFPINPALQEPLEVPTNEQAQVPL 437 >ref|XP_011084359.1| chorismate synthase 1, chloroplastic [Sesamum indicum] Length = 437 Score = 92.0 bits (227), Expect = 6e-19 Identities = 46/49 (93%), Positives = 47/49 (95%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLE K+EQAQ Sbjct: 386 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLEQRKSEQAQ 434 >gb|PHU17069.1| Chorismate synthase, chloroplastic [Capsicum chinense] Length = 435 Score = 90.1 bits (222), Expect = 3e-18 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPL+LS E A+ +L Sbjct: 384 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLQLSTTESAEITL 435 >gb|PHT80979.1| Chorismate synthase, chloroplastic [Capsicum annuum] Length = 435 Score = 90.1 bits (222), Expect = 3e-18 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPL+LS E A+ +L Sbjct: 384 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLQLSTTESAEITL 435 >ref|XP_016572296.1| PREDICTED: chorismate synthase 2, chloroplastic [Capsicum annuum] ref|XP_016572297.1| PREDICTED: chorismate synthase 2, chloroplastic [Capsicum annuum] Length = 435 Score = 90.1 bits (222), Expect = 3e-18 Identities = 45/52 (86%), Positives = 48/52 (92%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPL+LS E A+ +L Sbjct: 384 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLQLSTTESAEITL 435 >gb|PHT54236.1| Chorismate synthase, chloroplastic [Capsicum baccatum] Length = 435 Score = 89.0 bits (219), Expect = 7e-18 Identities = 44/52 (84%), Positives = 48/52 (92%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVLVDQLM+QYAQCMLFPINPALQEPL+LS E A+ +L Sbjct: 384 VPRAVPMVEAMVALVLVDQLMSQYAQCMLFPINPALQEPLQLSTTESAEITL 435 >emb|CDP04364.1| unnamed protein product [Coffea canephora] Length = 191 Score = 84.3 bits (207), Expect = 2e-17 Identities = 40/49 (81%), Positives = 46/49 (93%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPRAVPMVEAMVALVLVDQLMA +AQCMLFPINPALQEP+E++++E Q Sbjct: 142 VPRAVPMVEAMVALVLVDQLMAHHAQCMLFPINPALQEPVEMARSEPVQ 190 >ref|XP_022860610.1| chorismate synthase 1, chloroplastic-like isoform X5 [Olea europaea var. sylvestris] Length = 380 Score = 87.0 bits (214), Expect = 3e-17 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPR VP+VEAMVALVLVDQLMAQYAQC+LFPINPALQEPL+LSK++Q Q Sbjct: 329 VPRGVPVVEAMVALVLVDQLMAQYAQCVLFPINPALQEPLQLSKDKQLQ 377 >ref|XP_022860466.1| chorismate synthase 1, chloroplastic-like isoform X3 [Olea europaea var. sylvestris] Length = 393 Score = 87.0 bits (214), Expect = 3e-17 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPR VP+VEAMVALVLVDQLMAQYAQC+LFPINPALQEPL+LSK++Q Q Sbjct: 342 VPRGVPVVEAMVALVLVDQLMAQYAQCVLFPINPALQEPLQLSKDKQLQ 390 >ref|XP_022860408.1| chorismate synthase 1, chloroplastic-like isoform X2 [Olea europaea var. sylvestris] Length = 405 Score = 87.0 bits (214), Expect = 3e-17 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPR VP+VEAMVALVLVDQLMAQYAQC+LFPINPALQEPL+LSK++Q Q Sbjct: 354 VPRGVPVVEAMVALVLVDQLMAQYAQCVLFPINPALQEPLQLSKDKQLQ 402 >ref|XP_006359349.1| PREDICTED: chorismate synthase 2, chloroplastic isoform X2 [Solanum tuberosum] Length = 435 Score = 87.0 bits (214), Expect = 4e-17 Identities = 44/52 (84%), Positives = 45/52 (86%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVLVDQLM QYAQCMLFPINPALQEPL+ S E AQ L Sbjct: 384 VPRAVPMVEAMVALVLVDQLMTQYAQCMLFPINPALQEPLQSSTTESAQVPL 435 >ref|XP_022860335.1| chorismate synthase 2, chloroplastic-like isoform X1 [Olea europaea var. sylvestris] Length = 437 Score = 87.0 bits (214), Expect = 4e-17 Identities = 42/49 (85%), Positives = 47/49 (95%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPR VP+VEAMVALVLVDQLMAQYAQC+LFPINPALQEPL+LSK++Q Q Sbjct: 386 VPRGVPVVEAMVALVLVDQLMAQYAQCVLFPINPALQEPLQLSKDKQLQ 434 >ref|XP_006359348.1| PREDICTED: chorismate synthase 2, chloroplastic isoform X1 [Solanum tuberosum] Length = 437 Score = 87.0 bits (214), Expect = 4e-17 Identities = 44/52 (84%), Positives = 45/52 (86%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKSL 156 VPRAVPMVEAMVALVLVDQLM QYAQCMLFPINPALQEPL+ S E AQ L Sbjct: 386 VPRAVPMVEAMVALVLVDQLMTQYAQCMLFPINPALQEPLQSSTTESAQVPL 437 >dbj|BAD93818.1| hypothetical protein [Arabidopsis thaliana] Length = 88 Score = 80.5 bits (197), Expect = 5e-17 Identities = 39/48 (81%), Positives = 43/48 (89%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQA 144 VPRAVPMVEAMVALVLVDQLMAQYAQC LFPINP LQEPL++ + + A Sbjct: 38 VPRAVPMVEAMVALVLVDQLMAQYAQCHLFPINPELQEPLQIEQPQNA 85 >gb|PIN09701.1| Chorismate synthase [Handroanthus impetiginosus] Length = 193 Score = 82.0 bits (201), Expect = 2e-16 Identities = 40/49 (81%), Positives = 45/49 (91%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPRAVP+VEAMVALVLVDQ+MAQYAQCMLFPINPALQEPL L ++ A+ Sbjct: 142 VPRAVPIVEAMVALVLVDQIMAQYAQCMLFPINPALQEPLGLLNSDWAE 190 >ref|XP_010670014.1| PREDICTED: chorismate synthase 1, chloroplastic [Beta vulgaris subsp. vulgaris] gb|KMT17376.1| hypothetical protein BVRB_2g038310 [Beta vulgaris subsp. vulgaris] Length = 437 Score = 84.7 bits (208), Expect = 2e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQA 144 VPRAVPMVEAMVALVLVDQL+AQYAQC LFPINPALQEP+EL K ++A Sbjct: 388 VPRAVPMVEAMVALVLVDQLLAQYAQCQLFPINPALQEPMELPKLDEA 435 >ref|XP_022860923.1| chorismate synthase 1, chloroplastic-like [Olea europaea var. sylvestris] Length = 438 Score = 84.7 bits (208), Expect = 2e-16 Identities = 42/49 (85%), Positives = 44/49 (89%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQ 147 VPRAVPMVEA VALVLVDQLMAQYAQCMLFPINPALQE +EL+K E Q Sbjct: 387 VPRAVPMVEAAVALVLVDQLMAQYAQCMLFPINPALQESMELNKQEPVQ 435 >ref|XP_010461744.1| PREDICTED: chorismate synthase, chloroplastic-like [Camelina sativa] Length = 88 Score = 78.6 bits (192), Expect = 3e-16 Identities = 39/48 (81%), Positives = 41/48 (85%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQA 144 VPRAVPMVEAMVALVLVDQLMAQYAQC LFPINP LQEPL + + A Sbjct: 38 VPRAVPMVEAMVALVLVDQLMAQYAQCHLFPINPELQEPLHTEQPQNA 85 >gb|OVA18093.1| Chorismate synthase [Macleaya cordata] Length = 440 Score = 84.3 bits (207), Expect = 3e-16 Identities = 44/51 (86%), Positives = 44/51 (86%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQAQKS 153 VPRAVPMVEAMVALVLVDQLMAQYAQC LFPINPALQE LEL K E A S Sbjct: 389 VPRAVPMVEAMVALVLVDQLMAQYAQCQLFPINPALQESLELPKIEPATMS 439 >ref|XP_021757384.1| chorismate synthase 1, chloroplastic-like [Chenopodium quinoa] Length = 434 Score = 84.0 bits (206), Expect = 5e-16 Identities = 41/48 (85%), Positives = 45/48 (93%) Frame = +1 Query: 1 VPRAVPMVEAMVALVLVDQLMAQYAQCMLFPINPALQEPLELSKNEQA 144 VPRAVPMVEAMVALVLVDQLMAQYAQC LFPINPALQEP+EL + ++A Sbjct: 385 VPRAVPMVEAMVALVLVDQLMAQYAQCELFPINPALQEPMELPRLDEA 432