BLASTX nr result
ID: Rehmannia29_contig00008956
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00008956 (409 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011101879.1| small RNA degrading nuclease 5 isoform X2 [S... 102 2e-22 ref|XP_011101874.1| small RNA degrading nuclease 5 isoform X1 [S... 102 2e-22 ref|XP_012843244.1| PREDICTED: small RNA degrading nuclease 5 [E... 101 2e-22 gb|EYU32460.1| hypothetical protein MIMGU_mgv1a002280mg [Erythra... 101 3e-22 gb|PIN13014.1| 3'-5' exonuclease [Handroanthus impetiginosus] 100 6e-22 ref|XP_016501233.1| PREDICTED: small RNA degrading nuclease 5-li... 94 1e-21 ref|XP_019164209.1| PREDICTED: small RNA degrading nuclease 5 is... 97 1e-20 ref|XP_019164208.1| PREDICTED: small RNA degrading nuclease 5 is... 97 1e-20 gb|KZN08590.1| hypothetical protein DCAR_001120 [Daucus carota s... 94 3e-20 ref|XP_022850306.1| small RNA degrading nuclease 5 [Olea europae... 96 3e-20 gb|PHU19731.1| Small RNA degrading nuclease 5 [Capsicum chinense] 95 6e-20 gb|PHT50297.1| Small RNA degrading nuclease 5 [Capsicum baccatum] 95 6e-20 ref|XP_016569605.1| PREDICTED: small RNA degrading nuclease 5 is... 95 6e-20 ref|XP_016569604.1| PREDICTED: small RNA degrading nuclease 5 is... 95 7e-20 gb|PNT37408.1| hypothetical protein POPTR_005G186600v3 [Populus ... 94 8e-20 ref|XP_010999831.1| PREDICTED: small RNA degrading nuclease 5 is... 94 8e-20 ref|XP_002307475.1| exonuclease family protein [Populus trichoca... 94 8e-20 ref|XP_010999829.1| PREDICTED: small RNA degrading nuclease 5 is... 94 9e-20 gb|PNT37410.1| hypothetical protein POPTR_005G186600v3, partial ... 94 9e-20 ref|XP_016474732.1| PREDICTED: small RNA degrading nuclease 5 is... 94 1e-19 >ref|XP_011101879.1| small RNA degrading nuclease 5 isoform X2 [Sesamum indicum] Length = 562 Score = 102 bits (253), Expect = 2e-22 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTAIVQ+LRK+LSEQ+ETAL REKIVKVLEELQAQAEVGLCFVGIKH Sbjct: 509 VICTGHGDTAIVQKLRKMLSEQRETALCREKIVKVLEELQAQAEVGLCFVGIKH 562 >ref|XP_011101874.1| small RNA degrading nuclease 5 isoform X1 [Sesamum indicum] Length = 569 Score = 102 bits (253), Expect = 2e-22 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTAIVQ+LRK+LSEQ+ETAL REKIVKVLEELQAQAEVGLCFVGIKH Sbjct: 516 VICTGHGDTAIVQKLRKMLSEQRETALCREKIVKVLEELQAQAEVGLCFVGIKH 569 >ref|XP_012843244.1| PREDICTED: small RNA degrading nuclease 5 [Erythranthe guttata] Length = 628 Score = 101 bits (252), Expect = 2e-22 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTAIVQ+LRK+LSEQ ETALSREKIVKVLEE+QAQAE+GLCFVGIKH Sbjct: 575 VICTGHGDTAIVQKLRKILSEQTETALSREKIVKVLEEMQAQAEIGLCFVGIKH 628 >gb|EYU32460.1| hypothetical protein MIMGU_mgv1a002280mg [Erythranthe guttata] Length = 692 Score = 101 bits (252), Expect = 3e-22 Identities = 49/54 (90%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTAIVQ+LRK+LSEQ ETALSREKIVKVLEE+QAQAE+GLCFVGIKH Sbjct: 639 VICTGHGDTAIVQKLRKILSEQTETALSREKIVKVLEEMQAQAEIGLCFVGIKH 692 >gb|PIN13014.1| 3'-5' exonuclease [Handroanthus impetiginosus] Length = 570 Score = 100 bits (249), Expect = 6e-22 Identities = 49/54 (90%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDT IVQ+LRK+LSEQKETAL R+KIVKVLEELQAQAEVGLCFVGIKH Sbjct: 517 VICTGHGDTVIVQKLRKMLSEQKETALCRDKIVKVLEELQAQAEVGLCFVGIKH 570 >ref|XP_016501233.1| PREDICTED: small RNA degrading nuclease 5-like [Nicotiana tabacum] Length = 161 Score = 94.0 bits (232), Expect = 1e-21 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIVQ++RK+LSEQ + ++SRE IVKVLEELQAQAEVGLCFVG+KH Sbjct: 108 IICTGHGDTAIVQRVRKILSEQTDASMSRENIVKVLEELQAQAEVGLCFVGVKH 161 >ref|XP_019164209.1| PREDICTED: small RNA degrading nuclease 5 isoform X2 [Ipomoea nil] Length = 565 Score = 97.1 bits (240), Expect = 1e-20 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTAIVQ++RK+LSEQ ETA+SREK+VKVLE+LQAQAEVGLCF G+KH Sbjct: 512 VICTGHGDTAIVQRVRKILSEQTETAMSREKLVKVLEDLQAQAEVGLCFAGVKH 565 >ref|XP_019164208.1| PREDICTED: small RNA degrading nuclease 5 isoform X1 [Ipomoea nil] Length = 577 Score = 97.1 bits (240), Expect = 1e-20 Identities = 45/54 (83%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTAIVQ++RK+LSEQ ETA+SREK+VKVLE+LQAQAEVGLCF G+KH Sbjct: 524 VICTGHGDTAIVQRVRKILSEQTETAMSREKLVKVLEDLQAQAEVGLCFAGVKH 577 >gb|KZN08590.1| hypothetical protein DCAR_001120 [Daucus carota subsp. sativus] Length = 302 Score = 93.6 bits (231), Expect = 3e-20 Identities = 42/54 (77%), Positives = 51/54 (94%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTA+VQ+LR++L++Q ETAL RE I+KVLEELQAQAEVGLCFVG+KH Sbjct: 249 IICTGHGDTAVVQRLRRMLTQQVETALQREHIIKVLEELQAQAEVGLCFVGVKH 302 >ref|XP_022850306.1| small RNA degrading nuclease 5 [Olea europaea var. sylvestris] Length = 537 Score = 95.5 bits (236), Expect = 3e-20 Identities = 45/54 (83%), Positives = 50/54 (92%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 VICTGHGDTA V +LRK+LSEQ ETA+SREK+VK LEELQAQAEVGLCFVG+KH Sbjct: 484 VICTGHGDTAAVHRLRKILSEQTETAISREKLVKALEELQAQAEVGLCFVGVKH 537 >gb|PHU19731.1| Small RNA degrading nuclease 5 [Capsicum chinense] Length = 565 Score = 94.7 bits (234), Expect = 6e-20 Identities = 42/54 (77%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIVQ++RK+LSEQ ++++SREK+VKVLEELQAQAEVGLCFVG++H Sbjct: 512 IICTGHGDTAIVQRVRKILSEQTDSSMSREKVVKVLEELQAQAEVGLCFVGVRH 565 >gb|PHT50297.1| Small RNA degrading nuclease 5 [Capsicum baccatum] Length = 565 Score = 94.7 bits (234), Expect = 6e-20 Identities = 42/54 (77%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIVQ++RK+LSEQ ++++SREK+VKVLEELQAQAEVGLCFVG++H Sbjct: 512 IICTGHGDTAIVQRVRKILSEQTDSSMSREKVVKVLEELQAQAEVGLCFVGVRH 565 >ref|XP_016569605.1| PREDICTED: small RNA degrading nuclease 5 isoform X2 [Capsicum annuum] gb|PHT83884.1| Small RNA degrading nuclease 5 [Capsicum annuum] Length = 565 Score = 94.7 bits (234), Expect = 6e-20 Identities = 42/54 (77%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIVQ++RK+LSEQ ++++SREK+VKVLEELQAQAEVGLCFVG++H Sbjct: 512 IICTGHGDTAIVQRVRKILSEQTDSSMSREKVVKVLEELQAQAEVGLCFVGVRH 565 >ref|XP_016569604.1| PREDICTED: small RNA degrading nuclease 5 isoform X1 [Capsicum annuum] Length = 590 Score = 94.7 bits (234), Expect = 7e-20 Identities = 42/54 (77%), Positives = 53/54 (98%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIVQ++RK+LSEQ ++++SREK+VKVLEELQAQAEVGLCFVG++H Sbjct: 537 IICTGHGDTAIVQRVRKILSEQTDSSMSREKVVKVLEELQAQAEVGLCFVGVRH 590 >gb|PNT37408.1| hypothetical protein POPTR_005G186600v3 [Populus trichocarpa] Length = 505 Score = 94.4 bits (233), Expect = 8e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIV ++RK+L+EQKETA+SREKIVKVLEELQAQAEV LCFVG+K+ Sbjct: 452 IICTGHGDTAIVNRVRKMLAEQKETAISREKIVKVLEELQAQAEVALCFVGVKN 505 >ref|XP_010999831.1| PREDICTED: small RNA degrading nuclease 5 isoform X2 [Populus euphratica] Length = 545 Score = 94.4 bits (233), Expect = 8e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIV ++RK+L+EQKETA+SREKIVKVLEELQAQAEV LCFVG+K+ Sbjct: 492 IICTGHGDTAIVNRVRKMLAEQKETAMSREKIVKVLEELQAQAEVALCFVGVKN 545 >ref|XP_002307475.1| exonuclease family protein [Populus trichocarpa] Length = 545 Score = 94.4 bits (233), Expect = 8e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIV ++RK+L+EQKETA+SREKIVKVLEELQAQAEV LCFVG+K+ Sbjct: 492 IICTGHGDTAIVNRVRKMLAEQKETAISREKIVKVLEELQAQAEVALCFVGVKN 545 >ref|XP_010999829.1| PREDICTED: small RNA degrading nuclease 5 isoform X1 [Populus euphratica] ref|XP_010999830.1| PREDICTED: small RNA degrading nuclease 5 isoform X1 [Populus euphratica] Length = 576 Score = 94.4 bits (233), Expect = 9e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIV ++RK+L+EQKETA+SREKIVKVLEELQAQAEV LCFVG+K+ Sbjct: 523 IICTGHGDTAIVNRVRKMLAEQKETAMSREKIVKVLEELQAQAEVALCFVGVKN 576 >gb|PNT37410.1| hypothetical protein POPTR_005G186600v3, partial [Populus trichocarpa] Length = 613 Score = 94.4 bits (233), Expect = 9e-20 Identities = 44/54 (81%), Positives = 52/54 (96%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIV ++RK+L+EQKETA+SREKIVKVLEELQAQAEV LCFVG+K+ Sbjct: 560 IICTGHGDTAIVNRVRKMLAEQKETAISREKIVKVLEELQAQAEVALCFVGVKN 613 >ref|XP_016474732.1| PREDICTED: small RNA degrading nuclease 5 isoform X2 [Nicotiana tabacum] Length = 532 Score = 94.0 bits (232), Expect = 1e-19 Identities = 43/54 (79%), Positives = 51/54 (94%) Frame = -1 Query: 409 VICTGHGDTAIVQQLRKLLSEQKETALSREKIVKVLEELQAQAEVGLCFVGIKH 248 +ICTGHGDTAIVQ++RK+LSEQ + ++SRE IVKVLEELQAQAEVGLCFVG+KH Sbjct: 479 IICTGHGDTAIVQRVRKILSEQTDASMSRENIVKVLEELQAQAEVGLCFVGVKH 532