BLASTX nr result
ID: Rehmannia29_contig00008890
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00008890 (499 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIM98968.1| hypothetical protein CDL12_28539 [Handroanthus im... 54 8e-06 >gb|PIM98968.1| hypothetical protein CDL12_28539 [Handroanthus impetiginosus] Length = 151 Score = 53.5 bits (127), Expect = 8e-06 Identities = 26/32 (81%), Positives = 28/32 (87%) Frame = -1 Query: 235 TYSDALNKELKATTLDKTCVRAEEQSSKKNDE 140 +YSDALNKELKATTLDKT V A EQS+ KNDE Sbjct: 62 SYSDALNKELKATTLDKTFVHAHEQSTTKNDE 93