BLASTX nr result
ID: Rehmannia29_contig00008446
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00008446 (488 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN26266.1| hypothetical protein CDL12_00970 [Handroanthus im... 57 1e-06 >gb|PIN26266.1| hypothetical protein CDL12_00970 [Handroanthus impetiginosus] Length = 251 Score = 57.0 bits (136), Expect = 1e-06 Identities = 27/47 (57%), Positives = 30/47 (63%) Frame = +1 Query: 283 MNPAKALARIPTPLFCSKTRNSGPNVQLTLHFRRKSLSFLPTSFKRD 423 MNP KALARIP PLFC+KTRN GPN + F K PT +RD Sbjct: 1 MNPTKALARIPAPLFCTKTRNLGPNTKWAFCFHPKFSISAPTRLRRD 47