BLASTX nr result
ID: Rehmannia29_contig00008379
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00008379 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN14242.1| hypothetical protein CDL12_13139 [Handroanthus im... 55 2e-07 gb|PIN14245.1| hypothetical protein CDL12_13142 [Handroanthus im... 53 2e-06 >gb|PIN14242.1| hypothetical protein CDL12_13139 [Handroanthus impetiginosus] Length = 76 Score = 55.5 bits (132), Expect = 2e-07 Identities = 27/59 (45%), Positives = 36/59 (61%), Gaps = 4/59 (6%) Frame = +1 Query: 7 TQEPGNTGREKWVHXXXXXXXXX----KKNKFDYQDYEMRRIREAEKAEKIMNLICWGP 171 T E G+T R KWV K N +D+EMRRI+EA+KAEK+++L+CWGP Sbjct: 17 TPESGSTDRAKWVFGGGAATAAVEEVRKANILHSEDHEMRRIKEAQKAEKLIHLVCWGP 75 >gb|PIN14245.1| hypothetical protein CDL12_13142 [Handroanthus impetiginosus] Length = 76 Score = 53.1 bits (126), Expect = 2e-06 Identities = 27/59 (45%), Positives = 35/59 (59%), Gaps = 4/59 (6%) Frame = +1 Query: 7 TQEPGNTGREKWVHXXXXXXXXX----KKNKFDYQDYEMRRIREAEKAEKIMNLICWGP 171 T E G+T R KWV K N +D+EMRRI EA+KAEK+++L+CWGP Sbjct: 17 TPEFGSTDRAKWVFGGGAATAAVEEVRKANIHHSEDHEMRRIEEAQKAEKLIHLVCWGP 75