BLASTX nr result
ID: Rehmannia29_contig00008299
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00008299 (618 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012858868.1| PREDICTED: pentatricopeptide repeat-containi... 197 4e-56 gb|KZV53426.1| pentatricopeptide repeat-containing protein-like ... 196 7e-56 ref|XP_011076953.1| pentatricopeptide repeat-containing protein ... 192 2e-54 ref|XP_023929239.1| pentatricopeptide repeat-containing protein ... 187 5e-54 ref|XP_019168711.1| PREDICTED: pentatricopeptide repeat-containi... 190 1e-53 dbj|GAU35898.1| hypothetical protein TSUD_383900 [Trifolium subt... 180 1e-53 gb|KDP38027.1| hypothetical protein JCGZ_04670 [Jatropha curcas] 187 3e-53 ref|XP_008371757.1| PREDICTED: pentatricopeptide repeat-containi... 178 4e-53 ref|XP_023929238.1| pentatricopeptide repeat-containing protein ... 187 4e-53 gb|KVI12120.1| Pentatricopeptide repeat-containing protein [Cyna... 186 5e-53 ref|XP_015083851.1| PREDICTED: pentatricopeptide repeat-containi... 187 7e-53 ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containi... 187 7e-53 ref|XP_012072492.1| pentatricopeptide repeat-containing protein ... 187 9e-53 ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containi... 187 1e-52 ref|XP_016438034.1| PREDICTED: pentatricopeptide repeat-containi... 187 2e-52 ref|XP_009788184.1| PREDICTED: pentatricopeptide repeat-containi... 187 2e-52 ref|XP_016451057.1| PREDICTED: pentatricopeptide repeat-containi... 186 4e-52 gb|PHU28184.1| Pentatricopeptide repeat-containing protein [Caps... 185 5e-52 gb|PHT92285.1| Pentatricopeptide repeat-containing protein [Caps... 185 5e-52 ref|XP_016555834.1| PREDICTED: pentatricopeptide repeat-containi... 185 5e-52 >ref|XP_012858868.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Erythranthe guttata] Length = 622 Score = 197 bits (500), Expect = 4e-56 Identities = 92/104 (88%), Positives = 99/104 (95%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L EMTRLLRLEGYAPHTSNVLADIEEEEKE ALSYHSEKIAIAFVLINTPPGT +RIVKN Sbjct: 519 LSEMTRLLRLEGYAPHTSNVLADIEEEEKETALSYHSEKIAIAFVLINTPPGTLIRIVKN 578 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVC DCHLAIK++SKI++R+IVVRDCSRFHHF+DG CSCKDYW Sbjct: 579 LRVCGDCHLAIKLVSKIFRREIVVRDCSRFHHFKDGECSCKDYW 622 >gb|KZV53426.1| pentatricopeptide repeat-containing protein-like [Dorcoceras hygrometricum] Length = 594 Score = 196 bits (497), Expect = 7e-56 Identities = 91/104 (87%), Positives = 100/104 (96%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 LLEMTRLL+LEGYAPHTSNVLADIEEEEKE ALSYHSEKIAIAFVLINT PGTP+RI+KN Sbjct: 491 LLEMTRLLKLEGYAPHTSNVLADIEEEEKETALSYHSEKIAIAFVLINTTPGTPIRILKN 550 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LR+CADCHLAIK++SKI+ R+IVVRD SRFHHF+DGVCSCKDYW Sbjct: 551 LRICADCHLAIKLISKIFDREIVVRDRSRFHHFKDGVCSCKDYW 594 >ref|XP_011076953.1| pentatricopeptide repeat-containing protein At4g21065 [Sesamum indicum] Length = 620 Score = 192 bits (488), Expect = 2e-54 Identities = 91/104 (87%), Positives = 97/104 (93%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L EMTRLL+LEGYAPHT+NVLADIEEEEKE ALSYHSEKIAIAF LINTP GTP+RIVKN Sbjct: 517 LSEMTRLLKLEGYAPHTTNVLADIEEEEKETALSYHSEKIAIAFALINTPGGTPIRIVKN 576 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK+LSKI+ R+IVVRD SRFHHFRDG CSCKDYW Sbjct: 577 LRVCADCHLAIKLLSKIFDREIVVRDRSRFHHFRDGACSCKDYW 620 >ref|XP_023929239.1| pentatricopeptide repeat-containing protein At4g21065 isoform X2 [Quercus suber] Length = 432 Score = 187 bits (475), Expect = 5e-54 Identities = 84/104 (80%), Positives = 98/104 (94%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L E+T+LL+LEGY PHT+NVLADIEEEEKENALSYHSEKIAIAF+LINT PGTP+R+VKN Sbjct: 329 LAEITKLLKLEGYMPHTTNVLADIEEEEKENALSYHSEKIAIAFMLINTAPGTPIRVVKN 388 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LR CADCHLAIK++SK++KR+IVVRD SRFHHF+DG CSC+DYW Sbjct: 389 LRACADCHLAIKLISKVFKREIVVRDRSRFHHFKDGSCSCRDYW 432 >ref|XP_019168711.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Ipomoea nil] Length = 596 Score = 190 bits (482), Expect = 1e-53 Identities = 88/104 (84%), Positives = 96/104 (92%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L EMT LLR+EGY PHTSNVLADIEEEEKE ALSYHSEKIAIAFVLINTPPGTP+RIVKN Sbjct: 493 LAEMTNLLRIEGYVPHTSNVLADIEEEEKETALSYHSEKIAIAFVLINTPPGTPIRIVKN 552 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCH+AIK++SKIY R+IVVRD SRFHHF +G CSC+DYW Sbjct: 553 LRVCADCHVAIKLISKIYDREIVVRDRSRFHHFSNGACSCRDYW 596 >dbj|GAU35898.1| hypothetical protein TSUD_383900 [Trifolium subterraneum] Length = 219 Score = 180 bits (456), Expect = 1e-53 Identities = 80/104 (76%), Positives = 94/104 (90%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L ++T LL+LEGY PHT NVLADIEEEEKE ALSYHSEK+AIAF+L+NT PGTP+R+VKN Sbjct: 82 LEKITELLKLEGYVPHTENVLADIEEEEKEQALSYHSEKVAIAFMLLNTAPGTPIRVVKN 141 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCH+AIK++SK+Y R+IV+RD SRFHHFR G CSCKDYW Sbjct: 142 LRVCADCHMAIKLISKVYDREIVIRDRSRFHHFRGGSCSCKDYW 185 >gb|KDP38027.1| hypothetical protein JCGZ_04670 [Jatropha curcas] Length = 539 Score = 187 bits (476), Expect = 3e-53 Identities = 83/104 (79%), Positives = 98/104 (94%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 LLE+++ LRLEGY PHT+NVLADIEEEEKENAL YHSEKIA+AF+LINTPPGTP+R+VKN Sbjct: 436 LLEISKRLRLEGYVPHTANVLADIEEEEKENALFYHSEKIAVAFMLINTPPGTPIRVVKN 495 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK++ R+I+VRD SRFHHFRDG CSC+DYW Sbjct: 496 LRVCADCHLAIKLISKVFNREIIVRDRSRFHHFRDGSCSCRDYW 539 >ref|XP_008371757.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Malus domestica] Length = 210 Score = 178 bits (452), Expect = 4e-53 Identities = 82/104 (78%), Positives = 94/104 (90%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L ++TRLL+LEGY PHT+NVLADIEEEEKENALSYHSE IAIAF+L+NT PG P+RI KN Sbjct: 107 LADITRLLKLEGYVPHTTNVLADIEEEEKENALSYHSENIAIAFMLLNTAPGMPIRIWKN 166 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK+Y R+IVVRD SRFHHFRDG CSC+ YW Sbjct: 167 LRVCADCHLAIKLVSKVYDREIVVRDRSRFHHFRDGSCSCRYYW 210 >ref|XP_023929238.1| pentatricopeptide repeat-containing protein At4g21065 isoform X1 [Quercus suber] Length = 539 Score = 187 bits (475), Expect = 4e-53 Identities = 84/104 (80%), Positives = 98/104 (94%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L E+T+LL+LEGY PHT+NVLADIEEEEKENALSYHSEKIAIAF+LINT PGTP+R+VKN Sbjct: 436 LAEITKLLKLEGYMPHTTNVLADIEEEEKENALSYHSEKIAIAFMLINTAPGTPIRVVKN 495 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LR CADCHLAIK++SK++KR+IVVRD SRFHHF+DG CSC+DYW Sbjct: 496 LRACADCHLAIKLISKVFKREIVVRDRSRFHHFKDGSCSCRDYW 539 >gb|KVI12120.1| Pentatricopeptide repeat-containing protein [Cynara cardunculus var. scolymus] Length = 514 Score = 186 bits (473), Expect = 5e-53 Identities = 83/104 (79%), Positives = 97/104 (93%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L+E+T+LLRLEGY PH +NVLADIEEEEKE AL YH+EKIAIAF+LI TPPGTP+R+VKN Sbjct: 411 LIEITKLLRLEGYVPHVANVLADIEEEEKETALLYHNEKIAIAFMLIKTPPGTPIRVVKN 470 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCH+AIK++SK+YKR+IVVRD SRFHHF+DG CSCKDYW Sbjct: 471 LRVCADCHIAIKLISKVYKREIVVRDRSRFHHFKDGSCSCKDYW 514 >ref|XP_015083851.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Solanum pennellii] Length = 585 Score = 187 bits (476), Expect = 7e-53 Identities = 86/102 (84%), Positives = 97/102 (95%) Frame = +3 Query: 9 EMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKNLR 188 EMTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPGTP+RIVKNLR Sbjct: 484 EMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTPIRIVKNLR 543 Query: 189 VCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 VCADCHLAIK++SK+++R+IVVRD SRFHHF +G CSCKDYW Sbjct: 544 VCADCHLAIKLISKVFEREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_004244886.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Solanum lycopersicum] Length = 585 Score = 187 bits (476), Expect = 7e-53 Identities = 86/102 (84%), Positives = 97/102 (95%) Frame = +3 Query: 9 EMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKNLR 188 EMTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPGTP+RIVKNLR Sbjct: 484 EMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTPIRIVKNLR 543 Query: 189 VCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 VCADCHLAIK++SK+++R+IVVRD SRFHHF +G CSCKDYW Sbjct: 544 VCADCHLAIKLISKVFEREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_012072492.1| pentatricopeptide repeat-containing protein At4g21065 [Jatropha curcas] Length = 601 Score = 187 bits (476), Expect = 9e-53 Identities = 83/104 (79%), Positives = 98/104 (94%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 LLE+++ LRLEGY PHT+NVLADIEEEEKENAL YHSEKIA+AF+LINTPPGTP+R+VKN Sbjct: 498 LLEISKRLRLEGYVPHTANVLADIEEEEKENALFYHSEKIAVAFMLINTPPGTPIRVVKN 557 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK++ R+I+VRD SRFHHFRDG CSC+DYW Sbjct: 558 LRVCADCHLAIKLISKVFNREIIVRDRSRFHHFRDGSCSCRDYW 601 >ref|XP_006355278.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Solanum tuberosum] Length = 585 Score = 187 bits (474), Expect = 1e-52 Identities = 86/102 (84%), Positives = 96/102 (94%) Frame = +3 Query: 9 EMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKNLR 188 EMTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPGTP+RIVKNLR Sbjct: 484 EMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTPIRIVKNLR 543 Query: 189 VCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 VCADCHLAIK++SK++ R+IVVRD SRFHHF +G CSCKDYW Sbjct: 544 VCADCHLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 585 >ref|XP_016438034.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] ref|XP_016438035.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] ref|XP_016438036.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] ref|XP_016438037.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] ref|XP_016438039.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] Length = 593 Score = 187 bits (474), Expect = 2e-52 Identities = 87/104 (83%), Positives = 96/104 (92%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L EMTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPGT +RIVKN Sbjct: 490 LAEMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTSIRIVKN 549 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK+Y R+IVVRD SRFHHF +G CSCKDYW Sbjct: 550 LRVCADCHLAIKLISKVYDREIVVRDRSRFHHFNNGSCSCKDYW 593 >ref|XP_009788184.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Nicotiana sylvestris] ref|XP_009788185.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Nicotiana sylvestris] ref|XP_009788186.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Nicotiana sylvestris] Length = 593 Score = 187 bits (474), Expect = 2e-52 Identities = 87/104 (83%), Positives = 96/104 (92%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L EMTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPGT +RIVKN Sbjct: 490 LAEMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTSIRIVKN 549 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK+Y R+IVVRD SRFHHF +G CSCKDYW Sbjct: 550 LRVCADCHLAIKLISKVYDREIVVRDRSRFHHFNNGSCSCKDYW 593 >ref|XP_016451057.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] ref|XP_016451058.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065-like [Nicotiana tabacum] Length = 593 Score = 186 bits (471), Expect = 4e-52 Identities = 86/104 (82%), Positives = 97/104 (93%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L+EMTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPGT +RIVKN Sbjct: 490 LVEMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGTSIRIVKN 549 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK++ R+IVVRD SRFHHF +G CSCKDYW Sbjct: 550 LRVCADCHLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 593 >gb|PHU28184.1| Pentatricopeptide repeat-containing protein [Capsicum chinense] Length = 586 Score = 185 bits (470), Expect = 5e-52 Identities = 85/104 (81%), Positives = 97/104 (93%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L +MTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPG+P+RIVKN Sbjct: 483 LADMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGSPIRIVKN 542 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK++ R+IVVRD SRFHHF +G CSCKDYW Sbjct: 543 LRVCADCHLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 586 >gb|PHT92285.1| Pentatricopeptide repeat-containing protein [Capsicum annuum] Length = 586 Score = 185 bits (470), Expect = 5e-52 Identities = 85/104 (81%), Positives = 97/104 (93%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L +MTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPG+P+RIVKN Sbjct: 483 LADMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGSPIRIVKN 542 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK++ R+IVVRD SRFHHF +G CSCKDYW Sbjct: 543 LRVCADCHLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 586 >ref|XP_016555834.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21065 [Capsicum annuum] Length = 586 Score = 185 bits (470), Expect = 5e-52 Identities = 85/104 (81%), Positives = 97/104 (93%) Frame = +3 Query: 3 LLEMTRLLRLEGYAPHTSNVLADIEEEEKENALSYHSEKIAIAFVLINTPPGTPVRIVKN 182 L +MTRLLRLEGY PHTSNVLADIEEEEKE AL+YHSEKIAIAF+LI+TPPG+P+RIVKN Sbjct: 483 LADMTRLLRLEGYVPHTSNVLADIEEEEKETALAYHSEKIAIAFMLISTPPGSPIRIVKN 542 Query: 183 LRVCADCHLAIKILSKIYKRDIVVRDCSRFHHFRDGVCSCKDYW 314 LRVCADCHLAIK++SK++ R+IVVRD SRFHHF +G CSCKDYW Sbjct: 543 LRVCADCHLAIKLISKVFDREIVVRDRSRFHHFTNGSCSCKDYW 586