BLASTX nr result
ID: Rehmannia29_contig00007859
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00007859 (1342 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlise... 72 9e-12 ref|XP_022881055.1| LIM domain-containing protein A-like [Olea e... 69 7e-09 >gb|EPS64483.1| hypothetical protein M569_10301, partial [Genlisea aurea] Length = 96 Score = 71.6 bits (174), Expect = 9e-12 Identities = 34/41 (82%), Positives = 38/41 (92%) Frame = +2 Query: 779 DVLPVIIIPNAGRVVFMDAKKFMQLVEEKKKRVLAKKEAPL 901 D +PVIIIPNAGR V MDAKKF+QLVE+KKKR+LAKKEAPL Sbjct: 1 DAIPVIIIPNAGRFVSMDAKKFLQLVEDKKKRILAKKEAPL 41 >ref|XP_022881055.1| LIM domain-containing protein A-like [Olea europaea var. sylvestris] Length = 425 Score = 68.9 bits (167), Expect = 7e-09 Identities = 38/44 (86%), Positives = 39/44 (88%), Gaps = 3/44 (6%) Frame = +2 Query: 779 DVLPVIIIPNAGRVVF---MDAKKFMQLVEEKKKRVLAKKEAPL 901 D L VIIIPNAGRVVF MDAKKFMQLVEEKKKRVLAK+EAPL Sbjct: 85 DELLVIIIPNAGRVVFYIKMDAKKFMQLVEEKKKRVLAKREAPL 128