BLASTX nr result
ID: Rehmannia29_contig00007774
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00007774 (705 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN21986.1| hypothetical protein CDL12_05307 [Handroanthus im... 66 9e-09 ref|XP_011087616.1| protein root UVB sensitive 6 [Sesamum indicum] 66 9e-09 emb|CDO97668.1| unnamed protein product [Coffea canephora] 64 4e-08 gb|PIN13835.1| hypothetical protein CDL12_13541 [Handroanthus im... 62 2e-07 ref|XP_012840255.1| PREDICTED: protein root UVB sensitive 6 [Ery... 61 3e-07 gb|EYU35039.1| hypothetical protein MIMGU_mgv1a003370mg [Erythra... 61 4e-07 ref|XP_019249334.1| PREDICTED: protein root UVB sensitive 6 [Nic... 61 5e-07 ref|XP_009781135.1| PREDICTED: UPF0420 protein C16orf58 homolog ... 61 5e-07 ref|XP_009618721.1| PREDICTED: protein root UVB sensitive 6 [Nic... 61 5e-07 gb|PHT35718.1| Protein root UVB sensitive 6 [Capsicum baccatum] 61 5e-07 ref|XP_016545174.1| PREDICTED: protein root UVB sensitive 6 [Cap... 61 5e-07 ref|XP_016444126.1| PREDICTED: protein root UVB sensitive 6-like... 61 5e-07 ref|XP_022897022.1| protein root UVB sensitive 6 isoform X2 [Ole... 60 8e-07 ref|XP_022897021.1| protein root UVB sensitive 6 isoform X1 [Ole... 60 8e-07 gb|ACL52948.1| unknown [Zea mays] 54 1e-06 gb|KVH36188.1| Protein of unknown function DUF647 [Cynara cardun... 59 2e-06 gb|KQK06209.1| hypothetical protein BRADI_2g25111v3 [Brachypodiu... 54 2e-06 ref|XP_021981764.1| protein root UVB sensitive 6 [Helianthus ann... 59 2e-06 dbj|BAJ91620.1| predicted protein, partial [Hordeum vulgare subs... 54 3e-06 ref|XP_006366002.1| PREDICTED: protein root UVB sensitive 6 [Sol... 59 3e-06 >gb|PIN21986.1| hypothetical protein CDL12_05307 [Handroanthus impetiginosus] Length = 515 Score = 65.9 bits (159), Expect = 9e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELVR 93 GPFKNKAKEQGWVMS+SLLNPG+ARLCELVR Sbjct: 485 GPFKNKAKEQGWVMSDSLLNPGRARLCELVR 515 >ref|XP_011087616.1| protein root UVB sensitive 6 [Sesamum indicum] Length = 516 Score = 65.9 bits (159), Expect = 9e-09 Identities = 29/31 (93%), Positives = 31/31 (100%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELVR 93 GPFKNKAK+QGWVMSESLLNPG+ARLCELVR Sbjct: 486 GPFKNKAKDQGWVMSESLLNPGRARLCELVR 516 >emb|CDO97668.1| unnamed protein product [Coffea canephora] Length = 509 Score = 63.9 bits (154), Expect = 4e-08 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELVR 93 GPFK+KAKEQGWVMSESLLNPG+ARLCELV+ Sbjct: 479 GPFKSKAKEQGWVMSESLLNPGRARLCELVK 509 >gb|PIN13835.1| hypothetical protein CDL12_13541 [Handroanthus impetiginosus] Length = 507 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELV 90 GPFK KAKEQGWVMSESLLNPG+ARLCE+V Sbjct: 477 GPFKTKAKEQGWVMSESLLNPGRARLCEMV 506 >ref|XP_012840255.1| PREDICTED: protein root UVB sensitive 6 [Erythranthe guttata] Length = 513 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELV 90 GPFKNKAKEQGWVMS+SLLNPG+ARLC LV Sbjct: 484 GPFKNKAKEQGWVMSDSLLNPGRARLCGLV 513 >gb|EYU35039.1| hypothetical protein MIMGU_mgv1a003370mg [Erythranthe guttata] Length = 589 Score = 61.2 bits (147), Expect = 4e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELV 90 GPFKNKAKEQGWVMS+SLLNPG+ARLC LV Sbjct: 560 GPFKNKAKEQGWVMSDSLLNPGRARLCGLV 589 >ref|XP_019249334.1| PREDICTED: protein root UVB sensitive 6 [Nicotiana attenuata] gb|OIT00058.1| protein root uvb sensitive 6 [Nicotiana attenuata] Length = 511 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFK+KAKEQGWVMSESLLNPG+ARLCE+V+ Sbjct: 482 PFKSKAKEQGWVMSESLLNPGRARLCEMVK 511 >ref|XP_009781135.1| PREDICTED: UPF0420 protein C16orf58 homolog isoform X2 [Nicotiana sylvestris] ref|XP_016444138.1| PREDICTED: protein root UVB sensitive 6-like isoform X4 [Nicotiana tabacum] Length = 511 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFK+KAKEQGWVMSESLLNPG+ARLCE+V+ Sbjct: 482 PFKSKAKEQGWVMSESLLNPGRARLCEMVK 511 >ref|XP_009618721.1| PREDICTED: protein root UVB sensitive 6 [Nicotiana tomentosiformis] ref|XP_016472385.1| PREDICTED: protein root UVB sensitive 6-like [Nicotiana tabacum] Length = 511 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFK+KAKEQGWVMSESLLNPG+ARLCE+V+ Sbjct: 482 PFKSKAKEQGWVMSESLLNPGRARLCEMVK 511 >gb|PHT35718.1| Protein root UVB sensitive 6 [Capsicum baccatum] Length = 526 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFK+KAKEQGWVMSESLLNPG+ARLCE+V+ Sbjct: 497 PFKSKAKEQGWVMSESLLNPGRARLCEMVK 526 >ref|XP_016545174.1| PREDICTED: protein root UVB sensitive 6 [Capsicum annuum] gb|PHT69806.1| Protein root UVB sensitive 6 [Capsicum annuum] gb|PHU04313.1| Protein root UVB sensitive 6 [Capsicum chinense] Length = 526 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFK+KAKEQGWVMSESLLNPG+ARLCE+V+ Sbjct: 497 PFKSKAKEQGWVMSESLLNPGRARLCEMVK 526 >ref|XP_016444126.1| PREDICTED: protein root UVB sensitive 6-like isoform X2 [Nicotiana tabacum] Length = 541 Score = 60.8 bits (146), Expect = 5e-07 Identities = 26/30 (86%), Positives = 30/30 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFK+KAKEQGWVMSESLLNPG+ARLCE+V+ Sbjct: 512 PFKSKAKEQGWVMSESLLNPGRARLCEMVK 541 >ref|XP_022897022.1| protein root UVB sensitive 6 isoform X2 [Olea europaea var. sylvestris] Length = 506 Score = 60.1 bits (144), Expect = 8e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCEL 87 PFKNKAKEQGWVMSESLLNPG+ARLC+L Sbjct: 477 PFKNKAKEQGWVMSESLLNPGRARLCQL 504 >ref|XP_022897021.1| protein root UVB sensitive 6 isoform X1 [Olea europaea var. sylvestris] Length = 510 Score = 60.1 bits (144), Expect = 8e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCEL 87 PFKNKAKEQGWVMSESLLNPG+ARLC+L Sbjct: 481 PFKNKAKEQGWVMSESLLNPGRARLCQL 508 >gb|ACL52948.1| unknown [Zea mays] Length = 50 Score = 54.3 bits (129), Expect = 1e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLC 81 G FK KA+EQGW+MSESLLNPGKARLC Sbjct: 19 GTFKKKAREQGWIMSESLLNPGKARLC 45 >gb|KVH36188.1| Protein of unknown function DUF647 [Cynara cardunculus var. scolymus] Length = 509 Score = 59.3 bits (142), Expect = 2e-06 Identities = 25/30 (83%), Positives = 29/30 (96%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFKNKAKEQGWVMS+SLLNPG+AR+CE V+ Sbjct: 480 PFKNKAKEQGWVMSDSLLNPGRARICEQVK 509 >gb|KQK06209.1| hypothetical protein BRADI_2g25111v3 [Brachypodium distachyon] Length = 50 Score = 53.9 bits (128), Expect = 2e-06 Identities = 23/30 (76%), Positives = 27/30 (90%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLCELV 90 G FK KA+EQGW+MSESLLNPG+ARLC +V Sbjct: 19 GIFKRKAREQGWIMSESLLNPGRARLCGIV 48 >ref|XP_021981764.1| protein root UVB sensitive 6 [Helianthus annuus] gb|OTG14382.1| Protein of unknown function, DUF647 [Helianthus annuus] Length = 511 Score = 58.9 bits (141), Expect = 2e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCELVR 93 PFKNK KEQGWVMS+SLLNPG+AR+CE VR Sbjct: 482 PFKNKTKEQGWVMSDSLLNPGRARICEQVR 511 >dbj|BAJ91620.1| predicted protein, partial [Hordeum vulgare subsp. vulgare] Length = 80 Score = 54.3 bits (129), Expect = 3e-06 Identities = 23/27 (85%), Positives = 25/27 (92%) Frame = +1 Query: 1 GPFKNKAKEQGWVMSESLLNPGKARLC 81 G F+ KAKEQGW+MSESLLNPGKARLC Sbjct: 49 GTFRKKAKEQGWIMSESLLNPGKARLC 75 >ref|XP_006366002.1| PREDICTED: protein root UVB sensitive 6 [Solanum tuberosum] Length = 514 Score = 58.5 bits (140), Expect = 3e-06 Identities = 25/28 (89%), Positives = 28/28 (100%) Frame = +1 Query: 4 PFKNKAKEQGWVMSESLLNPGKARLCEL 87 PFK+KAKEQGWVMSESLLNPG+ARLCE+ Sbjct: 485 PFKSKAKEQGWVMSESLLNPGRARLCEM 512