BLASTX nr result
ID: Rehmannia29_contig00007716
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00007716 (474 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV14248.1| hypothetical protein F511_44063 [Dorcoceras hygro... 55 6e-06 >gb|KZV14248.1| hypothetical protein F511_44063 [Dorcoceras hygrometricum] Length = 561 Score = 55.5 bits (132), Expect = 6e-06 Identities = 21/39 (53%), Positives = 30/39 (76%) Frame = -3 Query: 178 MKIASWNVRGFKNPIKQKEIVTFVAKNNLDILCLLETKL 62 MK+A WN+RGF P+K K + + K+NLD++C+LETKL Sbjct: 1 MKVACWNIRGFHKPLKHKSVQAMMRKHNLDVVCILETKL 39