BLASTX nr result
ID: Rehmannia29_contig00007396
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00007396 (489 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN20724.1| hypothetical protein CDL12_06576 [Handroanthus im... 73 2e-14 dbj|GAY52936.1| hypothetical protein CUMW_145790, partial [Citru... 60 2e-08 >gb|PIN20724.1| hypothetical protein CDL12_06576 [Handroanthus impetiginosus] Length = 49 Score = 73.2 bits (178), Expect = 2e-14 Identities = 37/46 (80%), Positives = 40/46 (86%) Frame = +1 Query: 334 MRIVRGMQKLIREDQSLVCWKNKSLTRGIGVTAPKARTRDKLKPAS 471 MRIVRGMQK I EDQSLV WKN+SLT G G+TAPKARTRDKLK A+ Sbjct: 1 MRIVRGMQKSICEDQSLVGWKNESLTCGTGITAPKARTRDKLKRAA 46 >dbj|GAY52936.1| hypothetical protein CUMW_145790, partial [Citrus unshiu] Length = 125 Score = 59.7 bits (143), Expect = 2e-08 Identities = 31/49 (63%), Positives = 39/49 (79%), Gaps = 3/49 (6%) Frame = +1 Query: 319 GGQGLMRIVRGMQKLIREDQ---SLVCWKNKSLTRGIGVTAPKARTRDK 456 GG GLMRIVRGMQ+L RE+ +L+ WK +S ++GIG+T PKARTRDK Sbjct: 69 GGLGLMRIVRGMQRLFREELNKITLLSWK-ESFSQGIGITVPKARTRDK 116