BLASTX nr result
ID: Rehmannia29_contig00007098
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00007098 (411 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN23599.1| hypothetical protein CDL12_03671 [Handroanthus im... 74 3e-13 ref|XP_011085262.1| transcription factor bHLH144 [Sesamum indicu... 72 2e-12 ref|XP_007025132.2| PREDICTED: transcription factor bHLH144 [The... 68 5e-11 gb|EOY27754.1| Basic helix-loop-helix DNA-binding superfamily pr... 68 5e-11 gb|OMP08841.1| hypothetical protein COLO4_06070 [Corchorus olito... 68 6e-11 ref|XP_011096522.1| transcription factor bHLH144 [Sesamum indicu... 67 8e-11 ref|XP_021294939.1| transcription factor bHLH144 [Herrania umbra... 67 9e-11 gb|OMP02549.1| hypothetical protein CCACVL1_02762 [Corchorus cap... 67 1e-10 ref|XP_016697890.1| PREDICTED: transcription factor bHLH144-like... 66 1e-10 ref|XP_011011539.1| PREDICTED: transcription factor bHLH144-like... 67 2e-10 ref|XP_002316733.2| hypothetical protein POPTR_0011s02710g [Popu... 67 2e-10 ref|XP_022720306.1| transcription factor bHLH144-like [Durio zib... 67 2e-10 ref|XP_022879631.1| transcription factor bHLH144-like [Olea euro... 66 2e-10 ref|XP_016724025.1| PREDICTED: transcription factor bHLH144-like... 66 2e-10 gb|PPD69454.1| hypothetical protein GOBAR_DD33660 [Gossypium bar... 66 2e-10 ref|XP_016697889.1| PREDICTED: transcription factor bHLH144-like... 66 2e-10 ref|XP_012454337.1| PREDICTED: transcription factor bHLH144 [Gos... 66 2e-10 ref|XP_017649493.1| PREDICTED: transcription factor bHLH144-like... 66 2e-10 ref|XP_021599358.1| transcription factor bHLH144-like [Manihot e... 66 3e-10 ref|XP_010241336.1| PREDICTED: transcription factor bHLH144-like... 66 3e-10 >gb|PIN23599.1| hypothetical protein CDL12_03671 [Handroanthus impetiginosus] Length = 238 Score = 73.9 bits (180), Expect = 3e-13 Identities = 36/40 (90%), Positives = 38/40 (95%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFKG 290 RGIVPGANRMSTVAVLDE VRYLKS+RVEVQK+GVGN KG Sbjct: 199 RGIVPGANRMSTVAVLDEAVRYLKSLRVEVQKMGVGNAKG 238 >ref|XP_011085262.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011085263.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011085264.1| transcription factor bHLH144 [Sesamum indicum] Length = 235 Score = 71.6 bits (174), Expect = 2e-12 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFKG 290 RGIVPGANRMSTVAVLDE VRYLKS+RVEVQKL VGN KG Sbjct: 196 RGIVPGANRMSTVAVLDEAVRYLKSLRVEVQKLEVGNSKG 235 >ref|XP_007025132.2| PREDICTED: transcription factor bHLH144 [Theobroma cacao] Length = 243 Score = 68.2 bits (165), Expect = 5e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA++M TVAVLDE V+YLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADQMGTVAVLDEAVKYLKSLKVEVQKLGVGNFK 240 >gb|EOY27754.1| Basic helix-loop-helix DNA-binding superfamily protein, putative [Theobroma cacao] Length = 243 Score = 68.2 bits (165), Expect = 5e-11 Identities = 32/39 (82%), Positives = 37/39 (94%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA++M TVAVLDE V+YLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADQMGTVAVLDEAVKYLKSLKVEVQKLGVGNFK 240 >gb|OMP08841.1| hypothetical protein COLO4_06070 [Corchorus olitorius] Length = 243 Score = 67.8 bits (164), Expect = 6e-11 Identities = 32/39 (82%), Positives = 36/39 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TV+VLDE VRYLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADEMGTVSVLDEAVRYLKSLKVEVQKLGVGNFK 240 >ref|XP_011096522.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011096525.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_011096526.1| transcription factor bHLH144 [Sesamum indicum] ref|XP_020554104.1| transcription factor bHLH144 [Sesamum indicum] Length = 237 Score = 67.4 bits (163), Expect = 8e-11 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+RMSTVAVLDE VRYLKS+RVE QKLG NFK Sbjct: 196 RGIVPGASRMSTVAVLDEAVRYLKSLRVEAQKLGARNFK 234 >ref|XP_021294939.1| transcription factor bHLH144 [Herrania umbratica] Length = 243 Score = 67.4 bits (163), Expect = 9e-11 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNF 296 RGIVPGA++M TVAVLDE VRYLKS++VEVQKLGVGNF Sbjct: 202 RGIVPGADQMGTVAVLDEAVRYLKSLKVEVQKLGVGNF 239 >gb|OMP02549.1| hypothetical protein CCACVL1_02762 [Corchorus capsularis] Length = 242 Score = 67.0 bits (162), Expect = 1e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNF 296 RGIVPGA+ M TVAVLDE VRYLKS++VEVQKLGVGNF Sbjct: 201 RGIVPGADEMGTVAVLDEAVRYLKSLKVEVQKLGVGNF 238 >ref|XP_016697890.1| PREDICTED: transcription factor bHLH144-like isoform X2 [Gossypium hirsutum] Length = 200 Score = 66.2 bits (160), Expect = 1e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TVAVLD VRYLKS++VEVQKLGVGNFK Sbjct: 159 RGIVPGADEMDTVAVLDGAVRYLKSLKVEVQKLGVGNFK 197 >ref|XP_011011539.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] ref|XP_011011540.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] ref|XP_011011542.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] ref|XP_011011543.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] ref|XP_011011544.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] ref|XP_011011545.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] ref|XP_011011546.1| PREDICTED: transcription factor bHLH144-like [Populus euphratica] Length = 239 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPG ++M+TV VLDE VRYLKS++VEVQKLGVGNFK Sbjct: 200 RGIVPGGDQMNTVTVLDEAVRYLKSLKVEVQKLGVGNFK 238 >ref|XP_002316733.2| hypothetical protein POPTR_0011s02710g [Populus trichocarpa] ref|XP_006377244.1| hypothetical protein POPTR_0011s02710g [Populus trichocarpa] gb|PNT12355.1| hypothetical protein POPTR_011G080000v3 [Populus trichocarpa] Length = 239 Score = 66.6 bits (161), Expect = 2e-10 Identities = 31/39 (79%), Positives = 36/39 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPG ++M+TV VLDE VRYLKS++VEVQKLGVGNFK Sbjct: 200 RGIVPGGDQMNTVTVLDEAVRYLKSLKVEVQKLGVGNFK 238 >ref|XP_022720306.1| transcription factor bHLH144-like [Durio zibethinus] ref|XP_022720307.1| transcription factor bHLH144-like [Durio zibethinus] Length = 242 Score = 66.6 bits (161), Expect = 2e-10 Identities = 30/39 (76%), Positives = 37/39 (94%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGI+PGA++M TVAV+DE VRYLKS++VEV+KLGVGNFK Sbjct: 201 RGIIPGADQMGTVAVIDEAVRYLKSLKVEVKKLGVGNFK 239 >ref|XP_022879631.1| transcription factor bHLH144-like [Olea europaea var. sylvestris] ref|XP_022879632.1| transcription factor bHLH144-like [Olea europaea var. sylvestris] ref|XP_022879633.1| transcription factor bHLH144-like [Olea europaea var. sylvestris] Length = 233 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/37 (86%), Positives = 35/37 (94%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGN 299 RGIVPGAN+MSTVAVLDE VRYLKS+RVEVQ+ GVGN Sbjct: 192 RGIVPGANQMSTVAVLDEAVRYLKSLRVEVQETGVGN 228 >ref|XP_016724025.1| PREDICTED: transcription factor bHLH144-like [Gossypium hirsutum] ref|XP_016724026.1| PREDICTED: transcription factor bHLH144-like [Gossypium hirsutum] Length = 241 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TVAVLD VRYLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADEMDTVAVLDGAVRYLKSLKVEVQKLGVGNFK 240 >gb|PPD69454.1| hypothetical protein GOBAR_DD33660 [Gossypium barbadense] Length = 243 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TVAVLD VRYLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADEMDTVAVLDGAVRYLKSLKVEVQKLGVGNFK 240 >ref|XP_016697889.1| PREDICTED: transcription factor bHLH144-like isoform X1 [Gossypium hirsutum] Length = 243 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TVAVLD VRYLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADEMDTVAVLDGAVRYLKSLKVEVQKLGVGNFK 240 >ref|XP_012454337.1| PREDICTED: transcription factor bHLH144 [Gossypium raimondii] gb|KJB69779.1| hypothetical protein B456_011G042000 [Gossypium raimondii] gb|KJB69780.1| hypothetical protein B456_011G042000 [Gossypium raimondii] Length = 243 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TVAVLD VRYLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADEMDTVAVLDGAVRYLKSLKVEVQKLGVGNFK 240 >ref|XP_017649493.1| PREDICTED: transcription factor bHLH144-like [Gossypium arboreum] gb|KHG24843.1| Transcription factor protein [Gossypium arboreum] Length = 243 Score = 66.2 bits (160), Expect = 2e-10 Identities = 32/39 (82%), Positives = 35/39 (89%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPGA+ M TVAVLD VRYLKS++VEVQKLGVGNFK Sbjct: 202 RGIVPGADEMDTVAVLDGAVRYLKSLKVEVQKLGVGNFK 240 >ref|XP_021599358.1| transcription factor bHLH144-like [Manihot esculenta] gb|OAY25107.1| hypothetical protein MANES_17G067600 [Manihot esculenta] Length = 238 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 RGIVPG ++M+TV VLDE VRYLKS++VEVQK+GVGNFK Sbjct: 199 RGIVPGGDQMNTVTVLDEAVRYLKSLKVEVQKIGVGNFK 237 >ref|XP_010241336.1| PREDICTED: transcription factor bHLH144-like [Nelumbo nucifera] ref|XP_010241337.1| PREDICTED: transcription factor bHLH144-like [Nelumbo nucifera] Length = 238 Score = 65.9 bits (159), Expect = 3e-10 Identities = 30/39 (76%), Positives = 36/39 (92%) Frame = -3 Query: 409 RGIVPGANRMSTVAVLDETVRYLKSIRVEVQKLGVGNFK 293 +GIVPG +MSTVAVLDE VRYLKS++VEV+KLG+GNFK Sbjct: 199 KGIVPGGKQMSTVAVLDEAVRYLKSLKVEVKKLGIGNFK 237