BLASTX nr result
ID: Rehmannia29_contig00006990
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00006990 (626 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011084465.1| probable NADH dehydrogenase [ubiquinone] 1 a... 61 4e-08 gb|KZV46054.1| putative NADH dehydrogenase [Dorcoceras hygrometr... 60 9e-08 ref|XP_012858548.1| PREDICTED: probable NADH dehydrogenase [ubiq... 60 1e-07 gb|PIN10389.1| NADH:ubiquinone oxidoreductase, NDUFA5/B13 subuni... 59 3e-07 ref|XP_011076090.1| probable NADH dehydrogenase [ubiquinone] 1 a... 56 4e-06 >ref|XP_011084465.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Sesamum indicum] Length = 178 Score = 61.2 bits (147), Expect = 4e-08 Identities = 29/31 (93%), Positives = 30/31 (96%) Frame = +1 Query: 1 LHRPGPLPEEFYKTLEAVDTGTLKLAISASK 93 LHRPGPLPEEFYKTLEAVDTGTLK AIS+SK Sbjct: 134 LHRPGPLPEEFYKTLEAVDTGTLKDAISSSK 164 >gb|KZV46054.1| putative NADH dehydrogenase [Dorcoceras hygrometricum] Length = 171 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 1 LHRPGPLPEEFYKTLEAVDTGTLKLAISASK 93 LHRPGPLPEEFYKTLEAVDTGTL AIS+SK Sbjct: 134 LHRPGPLPEEFYKTLEAVDTGTLNQAISSSK 164 >ref|XP_012858548.1| PREDICTED: probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Erythranthe guttata] gb|EYU19587.1| hypothetical protein MIMGU_mgv1a014787mg [Erythranthe guttata] Length = 178 Score = 59.7 bits (143), Expect = 1e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +1 Query: 1 LHRPGPLPEEFYKTLEAVDTGTLKLAISASK 93 LHRPGPLPEEFYKTLEA+DTGTLK AIS S+ Sbjct: 134 LHRPGPLPEEFYKTLEAIDTGTLKQAISVSE 164 >gb|PIN10389.1| NADH:ubiquinone oxidoreductase, NDUFA5/B13 subunit [Handroanthus impetiginosus] Length = 178 Score = 58.9 bits (141), Expect = 3e-07 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = +1 Query: 4 HRPGPLPEEFYKTLEAVDTGTLKLAISASK 93 HRPGPLPEEFYKTLEAVDTGTLK AIS+S+ Sbjct: 135 HRPGPLPEEFYKTLEAVDTGTLKQAISSSE 164 >ref|XP_011076090.1| probable NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5, mitochondrial [Sesamum indicum] Length = 178 Score = 55.8 bits (133), Expect = 4e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +1 Query: 1 LHRPGPLPEEFYKTLEAVDTGTLKLAISASK 93 LHRPGPLPEEFY TLEAV+TGTLK ISAS+ Sbjct: 134 LHRPGPLPEEFYTTLEAVETGTLKQIISASE 164