BLASTX nr result
ID: Rehmannia29_contig00005830
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00005830 (1296 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012827565.1| PREDICTED: G-type lectin S-receptor-like ser... 77 4e-11 gb|PIN16323.1| Serine/threonine protein kinase [Handroanthus imp... 74 4e-10 gb|PHT89266.1| hypothetical protein T459_04379 [Capsicum annuum] 66 4e-10 ref|XP_022876893.1| G-type lectin S-receptor-like serine/threoni... 73 7e-10 ref|XP_022889428.1| G-type lectin S-receptor-like serine/threoni... 65 1e-09 ref|XP_012843481.1| PREDICTED: G-type lectin S-receptor-like ser... 71 1e-09 ref|XP_022877625.1| G-type lectin S-receptor-like serine/threoni... 72 1e-09 ref|XP_022877624.1| G-type lectin S-receptor-like serine/threoni... 72 1e-09 ref|XP_012843086.1| PREDICTED: G-type lectin S-receptor-like ser... 70 2e-09 gb|EYU32317.1| hypothetical protein MIMGU_mgv1a006448mg [Erythra... 71 2e-09 gb|EYU32850.1| hypothetical protein MIMGU_mgv1a001388mg [Erythra... 71 3e-09 gb|EYU32849.1| hypothetical protein MIMGU_mgv1a001388mg [Erythra... 71 3e-09 ref|XP_012843085.1| PREDICTED: G-type lectin S-receptor-like ser... 71 3e-09 ref|XP_012843084.1| PREDICTED: G-type lectin S-receptor-like ser... 71 3e-09 ref|XP_012843082.1| PREDICTED: G-type lectin S-receptor-like ser... 71 3e-09 gb|EYU43469.1| hypothetical protein MIMGU_mgv1a021617mg, partial... 70 3e-09 ref|XP_012829990.1| PREDICTED: G-type lectin S-receptor-like ser... 70 3e-09 ref|XP_022877612.1| G-type lectin S-receptor-like serine/threoni... 69 3e-09 gb|EYU32848.1| hypothetical protein MIMGU_mgv1a022873mg [Erythra... 70 3e-09 ref|XP_022877614.1| G-type lectin S-receptor-like serine/threoni... 70 3e-09 >ref|XP_012827565.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Erythranthe guttata] Length = 813 Score = 76.6 bits (187), Expect = 4e-11 Identities = 39/61 (63%), Positives = 47/61 (77%), Gaps = 1/61 (1%) Frame = -2 Query: 533 VYSPKQNELLFVLVMIH-KIHNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVT 357 ++ K+N+ V IH + NKD +LPLFDLSTISKATN+FSI NK+GEGGYGPVYK T Sbjct: 453 IWKRKKNDKTGERVGIHTETENKDFQLPLFDLSTISKATNNFSIENKIGEGGYGPVYKGT 512 Query: 356 L 354 L Sbjct: 513 L 513 >gb|PIN16323.1| Serine/threonine protein kinase [Handroanthus impetiginosus] Length = 807 Score = 73.6 bits (179), Expect = 4e-10 Identities = 34/41 (82%), Positives = 37/41 (90%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 HNKDL LP FDLSTISKATN+FS+ NKLGEGG+GPVYK TL Sbjct: 468 HNKDLNLPSFDLSTISKATNNFSLENKLGEGGFGPVYKGTL 508 >gb|PHT89266.1| hypothetical protein T459_04379 [Capsicum annuum] Length = 61 Score = 65.9 bits (159), Expect = 4e-10 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -2 Query: 473 NKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTLYSSIFSFL 330 +++L+LPLFD TIS ATN+ S+ NKLGEGG+GPVYKVT+ ++ S L Sbjct: 9 DEELDLPLFDFETISHATNNISLNNKLGEGGFGPVYKVTMLTAALSVL 56 >ref|XP_022876893.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Olea europaea var. sylvestris] Length = 1348 Score = 72.8 bits (177), Expect = 7e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYK 363 HN+D ELPLFDLSTISKATN+FSI NKLG+GGYGPVYK Sbjct: 203 HNEDHELPLFDLSTISKATNNFSINNKLGQGGYGPVYK 240 Score = 72.8 bits (177), Expect = 7e-10 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYK 363 HN+D ELPLFDLSTISKATN+FSI NKLG+GGYGPVYK Sbjct: 1014 HNEDHELPLFDLSTISKATNNFSINNKLGQGGYGPVYK 1051 >ref|XP_022889428.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Olea europaea var. sylvestris] Length = 88 Score = 65.5 bits (158), Expect = 1e-09 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKV 360 H KD ELPL+ STISKATN+FS NKLG+GGYGPVYKV Sbjct: 34 HKKDYELPLYRASTISKATNNFSENNKLGQGGYGPVYKV 72 >ref|XP_012843481.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Erythranthe guttata] Length = 365 Score = 70.9 bits (172), Expect = 1e-09 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 473 NKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTLYS 348 N+DLELPLFDLSTISKAT SFS NKLGEGG+GPVYK TL S Sbjct: 28 NEDLELPLFDLSTISKATESFSPNNKLGEGGFGPVYKGTLGS 69 >ref|XP_022877625.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Olea europaea var. sylvestris] Length = 661 Score = 71.6 bits (174), Expect = 1e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYK 363 HNKD+E+P+FDL TISKATN+FS+ NKLGEGG+GPVYK Sbjct: 475 HNKDIEIPMFDLYTISKATNNFSVNNKLGEGGFGPVYK 512 >ref|XP_022877624.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X1 [Olea europaea var. sylvestris] Length = 810 Score = 71.6 bits (174), Expect = 1e-09 Identities = 30/38 (78%), Positives = 36/38 (94%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYK 363 HNKD+E+P+FDL TISKATN+FS+ NKLGEGG+GPVYK Sbjct: 475 HNKDIEIPMFDLYTISKATNNFSVNNKLGEGGFGPVYK 512 >ref|XP_012843086.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 [Erythranthe guttata] Length = 366 Score = 70.5 bits (171), Expect = 2e-09 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT++FS+ NKLGEGG+GPVYK TL Sbjct: 31 KDLELPLFDLSTISKATHNFSLDNKLGEGGFGPVYKGTL 69 >gb|EYU32317.1| hypothetical protein MIMGU_mgv1a006448mg [Erythranthe guttata] Length = 444 Score = 70.9 bits (172), Expect = 2e-09 Identities = 35/42 (83%), Positives = 37/42 (88%) Frame = -2 Query: 473 NKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTLYS 348 N+DLELPLFDLSTISKAT SFS NKLGEGG+GPVYK TL S Sbjct: 107 NEDLELPLFDLSTISKATESFSPNNKLGEGGFGPVYKGTLGS 148 >gb|EYU32850.1| hypothetical protein MIMGU_mgv1a001388mg [Erythranthe guttata] Length = 826 Score = 70.9 bits (172), Expect = 3e-09 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT +FSI NKLGEGG+GPVYK TL Sbjct: 476 KDLELPLFDLSTISKATRNFSIDNKLGEGGFGPVYKGTL 514 >gb|EYU32849.1| hypothetical protein MIMGU_mgv1a001388mg [Erythranthe guttata] Length = 827 Score = 70.9 bits (172), Expect = 3e-09 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT +FSI NKLGEGG+GPVYK TL Sbjct: 476 KDLELPLFDLSTISKATRNFSIDNKLGEGGFGPVYKGTL 514 >ref|XP_012843085.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X3 [Erythranthe guttata] Length = 829 Score = 70.9 bits (172), Expect = 3e-09 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT +FSI NKLGEGG+GPVYK TL Sbjct: 479 KDLELPLFDLSTISKATRNFSIDNKLGEGGFGPVYKGTL 517 >ref|XP_012843084.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X2 [Erythranthe guttata] Length = 831 Score = 70.9 bits (172), Expect = 3e-09 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT +FSI NKLGEGG+GPVYK TL Sbjct: 481 KDLELPLFDLSTISKATRNFSIDNKLGEGGFGPVYKGTL 519 >ref|XP_012843082.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X1 [Erythranthe guttata] Length = 833 Score = 70.9 bits (172), Expect = 3e-09 Identities = 34/39 (87%), Positives = 36/39 (92%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT +FSI NKLGEGG+GPVYK TL Sbjct: 483 KDLELPLFDLSTISKATRNFSIDNKLGEGGFGPVYKGTL 521 >gb|EYU43469.1| hypothetical protein MIMGU_mgv1a021617mg, partial [Erythranthe guttata] Length = 536 Score = 70.5 bits (171), Expect = 3e-09 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT++FS+ NKLGEGG+GPVYK TL Sbjct: 431 KDLELPLFDLSTISKATHNFSLDNKLGEGGFGPVYKGTL 469 >ref|XP_012829990.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290, partial [Erythranthe guttata] Length = 622 Score = 70.5 bits (171), Expect = 3e-09 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT++FS+ NKLGEGG+GPVYK TL Sbjct: 479 KDLELPLFDLSTISKATHNFSLDNKLGEGGFGPVYKGTL 517 >ref|XP_022877612.1| G-type lectin S-receptor-like serine/threonine-protein kinase SD1-1 isoform X3 [Olea europaea var. sylvestris] Length = 340 Score = 69.3 bits (168), Expect = 3e-09 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYK 363 HNKD+E+P+FDL TISKATN+FS NKLGEGG+GPVYK Sbjct: 5 HNKDIEIPMFDLYTISKATNNFSDNNKLGEGGFGPVYK 42 >gb|EYU32848.1| hypothetical protein MIMGU_mgv1a022873mg [Erythranthe guttata] Length = 811 Score = 70.5 bits (171), Expect = 3e-09 Identities = 33/39 (84%), Positives = 37/39 (94%) Frame = -2 Query: 470 KDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYKVTL 354 KDLELPLFDLSTISKAT++FS+ NKLGEGG+GPVYK TL Sbjct: 476 KDLELPLFDLSTISKATHNFSLDNKLGEGGFGPVYKGTL 514 >ref|XP_022877614.1| G-type lectin S-receptor-like serine/threonine-protein kinase At4g27290 isoform X1 [Olea europaea var. sylvestris] Length = 823 Score = 70.5 bits (171), Expect = 3e-09 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -2 Query: 476 HNKDLELPLFDLSTISKATNSFSITNKLGEGGYGPVYK 363 HNKD+ELPLFDL TI+KAT++FSI NKLGEGG+GPVYK Sbjct: 485 HNKDIELPLFDLHTITKATDNFSIDNKLGEGGFGPVYK 522