BLASTX nr result
ID: Rehmannia29_contig00005518
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00005518 (449 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|OIW10297.1| hypothetical protein TanjilG_28048 [Lupinus angus... 105 3e-27 gb|OIV94048.1| hypothetical protein TanjilG_14295 [Lupinus angus... 104 6e-27 gb|PIN24086.1| Cullin [Handroanthus impetiginosus] 115 8e-27 gb|KYP45394.1| Cullin-3 [Cajanus cajan] 105 9e-27 gb|EYU22430.1| hypothetical protein MIMGU_mgv1a022204mg [Erythra... 113 4e-26 ref|XP_012855284.1| PREDICTED: LOW QUALITY PROTEIN: cullin-3A-li... 113 4e-26 ref|XP_011071007.1| cullin-3A-like [Sesamum indicum] 113 4e-26 gb|OIW04749.1| hypothetical protein TanjilG_08632 [Lupinus angus... 102 4e-26 ref|XP_022877390.1| cullin-3A-like [Olea europaea var. sylvestri... 112 5e-26 gb|EPS73775.1| hypothetical protein M569_00979 [Genlisea aurea] 112 5e-26 ref|XP_004228381.1| PREDICTED: cullin-3A [Solanum lycopersicum] ... 112 5e-26 gb|PIN00161.1| Cullin [Handroanthus impetiginosus] 112 7e-26 ref|XP_012837463.1| PREDICTED: cullin-3A-like [Erythranthe gutta... 112 9e-26 ref|XP_019225623.1| PREDICTED: cullin-3A-like [Nicotiana attenua... 111 1e-25 ref|XP_009804049.1| PREDICTED: cullin-3A-like [Nicotiana sylvest... 111 1e-25 ref|XP_009603836.1| PREDICTED: cullin-3A [Nicotiana tomentosifor... 111 1e-25 ref|XP_006366700.1| PREDICTED: cullin-3A [Solanum tuberosum] 111 1e-25 ref|XP_011075492.1| cullin-3A-like [Sesamum indicum] 111 2e-25 ref|XP_009341005.1| PREDICTED: cullin-3A-like [Pyrus x bretschne... 110 3e-25 ref|XP_008341566.1| PREDICTED: cullin-3A-like [Malus domestica] 110 3e-25 >gb|OIW10297.1| hypothetical protein TanjilG_28048 [Lupinus angustifolius] Length = 72 Score = 105 bits (263), Expect = 3e-27 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = -1 Query: 158 SGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 S QKKRNFQIEAFKH+VV+DPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 2 SNQKKRNFQIEAFKHRVVMDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 53 >gb|OIV94048.1| hypothetical protein TanjilG_14295 [Lupinus angustifolius] Length = 54 Score = 104 bits (260), Expect = 6e-27 Identities = 47/52 (90%), Positives = 51/52 (98%) Frame = -1 Query: 158 SGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 S Q+KRNFQIEAFKH+VV+DPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 2 SNQRKRNFQIEAFKHRVVMDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 53 >gb|PIN24086.1| Cullin [Handroanthus impetiginosus] Length = 734 Score = 115 bits (287), Expect = 8e-27 Identities = 54/54 (100%), Positives = 54/54 (100%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 54 >gb|KYP45394.1| Cullin-3 [Cajanus cajan] Length = 108 Score = 105 bits (263), Expect = 9e-27 Identities = 48/52 (92%), Positives = 51/52 (98%) Frame = -1 Query: 158 SGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 S QKKRNFQIEAFKH+VV+DPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 2 SNQKKRNFQIEAFKHRVVMDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 53 >gb|EYU22430.1| hypothetical protein MIMGU_mgv1a022204mg [Erythranthe guttata] Length = 700 Score = 113 bits (282), Expect = 4e-26 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSSG KKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSGHKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_012855284.1| PREDICTED: LOW QUALITY PROTEIN: cullin-3A-like [Erythranthe guttata] Length = 734 Score = 113 bits (282), Expect = 4e-26 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSSG KKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSGHKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_011071007.1| cullin-3A-like [Sesamum indicum] Length = 734 Score = 113 bits (282), Expect = 4e-26 Identities = 53/54 (98%), Positives = 54/54 (100%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIY+HNASGLSFEELY Sbjct: 1 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYSHNASGLSFEELY 54 >gb|OIW04749.1| hypothetical protein TanjilG_08632 [Lupinus angustifolius] Length = 61 Score = 102 bits (255), Expect = 4e-26 Identities = 46/52 (88%), Positives = 50/52 (96%) Frame = -1 Query: 158 SGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 S Q+KRNFQIEAFKH+VV+DPKYA+KTW ILEHAIHEIYNHNASGLSFEELY Sbjct: 2 SNQRKRNFQIEAFKHRVVMDPKYADKTWNILEHAIHEIYNHNASGLSFEELY 53 >ref|XP_022877390.1| cullin-3A-like [Olea europaea var. sylvestris] ref|XP_022877398.1| cullin-3A-like [Olea europaea var. sylvestris] Length = 734 Score = 112 bits (281), Expect = 5e-26 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 M+SGQKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MNSGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >gb|EPS73775.1| hypothetical protein M569_00979 [Genlisea aurea] Length = 734 Score = 112 bits (281), Expect = 5e-26 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSSGQKK+NFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSGQKKKNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_004228381.1| PREDICTED: cullin-3A [Solanum lycopersicum] ref|XP_015062452.1| PREDICTED: cullin-3A [Solanum pennellii] Length = 734 Score = 112 bits (281), Expect = 5e-26 Identities = 53/54 (98%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSS QKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 54 >gb|PIN00161.1| Cullin [Handroanthus impetiginosus] Length = 734 Score = 112 bits (280), Expect = 7e-26 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MS GQKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSGGQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_012837463.1| PREDICTED: cullin-3A-like [Erythranthe guttata] gb|EYU37409.1| hypothetical protein MIMGU_mgv1a001957mg [Erythranthe guttata] Length = 734 Score = 112 bits (279), Expect = 9e-26 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSSG KKRNFQIEAFKHKVVVDPKYAEKTWKIL+HAIHEIYNHNASGLSFEELY Sbjct: 1 MSSGHKKRNFQIEAFKHKVVVDPKYAEKTWKILDHAIHEIYNHNASGLSFEELY 54 >ref|XP_019225623.1| PREDICTED: cullin-3A-like [Nicotiana attenuata] gb|OIT32540.1| cullin-3a [Nicotiana attenuata] Length = 734 Score = 111 bits (278), Expect = 1e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSS QKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_009804049.1| PREDICTED: cullin-3A-like [Nicotiana sylvestris] ref|XP_016495387.1| PREDICTED: cullin-3A-like [Nicotiana tabacum] Length = 734 Score = 111 bits (278), Expect = 1e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSS QKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_009603836.1| PREDICTED: cullin-3A [Nicotiana tomentosiformis] Length = 734 Score = 111 bits (278), Expect = 1e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSS QKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_006366700.1| PREDICTED: cullin-3A [Solanum tuberosum] Length = 734 Score = 111 bits (278), Expect = 1e-25 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MSS QKKRNFQIEAFKHKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSSNQKKRNFQIEAFKHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_011075492.1| cullin-3A-like [Sesamum indicum] Length = 734 Score = 111 bits (277), Expect = 2e-25 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -1 Query: 164 MSSGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 MS GQKKRNFQIEAF+HKVVVDPKYA+KTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 1 MSGGQKKRNFQIEAFRHKVVVDPKYADKTWKILEHAIHEIYNHNASGLSFEELY 54 >ref|XP_009341005.1| PREDICTED: cullin-3A-like [Pyrus x bretschneideri] Length = 733 Score = 110 bits (275), Expect = 3e-25 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -1 Query: 158 SGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 SGQKKRNFQIEAFKH+VVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 2 SGQKKRNFQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 53 >ref|XP_008341566.1| PREDICTED: cullin-3A-like [Malus domestica] Length = 733 Score = 110 bits (275), Expect = 3e-25 Identities = 51/52 (98%), Positives = 52/52 (100%) Frame = -1 Query: 158 SGQKKRNFQIEAFKHKVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 3 SGQKKRNFQIEAFKH+VVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY Sbjct: 2 SGQKKRNFQIEAFKHRVVVDPKYAEKTWKILEHAIHEIYNHNASGLSFEELY 53