BLASTX nr result
ID: Rehmannia29_contig00004681
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00004681 (611 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN22303.1| Mitochondrial import inner membrane translocase, ... 117 1e-29 ref|XP_011072553.1| mitochondrial import inner membrane transloc... 116 5e-29 ref|XP_012856473.1| PREDICTED: mitochondrial import inner membra... 113 7e-28 gb|PIN14647.1| Mitochondrial import inner membrane translocase, ... 112 1e-27 ref|XP_011079930.1| mitochondrial import inner membrane transloc... 112 2e-27 ref|XP_012836514.1| PREDICTED: mitochondrial import inner membra... 110 6e-27 ref|XP_019266067.1| PREDICTED: mitochondrial import inner membra... 99 3e-22 ref|XP_009795181.1| PREDICTED: mitochondrial import inner membra... 99 3e-22 ref|XP_009616035.1| PREDICTED: mitochondrial import inner membra... 99 3e-22 ref|XP_016510052.1| PREDICTED: mitochondrial import inner membra... 99 4e-22 ref|XP_006342960.1| PREDICTED: mitochondrial import inner membra... 97 1e-21 ref|XP_022844521.1| mitochondrial import inner membrane transloc... 96 4e-21 ref|XP_015067553.1| PREDICTED: mitochondrial import inner membra... 96 4e-21 ref|XP_021997078.1| mitochondrial import inner membrane transloc... 96 5e-21 gb|OTG04276.1| hypothetical protein HannXRQ_Chr12g0360471 [Helia... 96 7e-21 ref|XP_004235579.1| PREDICTED: mitochondrial import inner membra... 95 7e-21 gb|KVH92977.1| Mitochondrial inner membrane translocase subunit ... 95 1e-20 ref|XP_023758865.1| mitochondrial import inner membrane transloc... 94 1e-20 ref|XP_021989967.1| mitochondrial import inner membrane transloc... 94 2e-20 ref|XP_022889609.1| mitochondrial import inner membrane transloc... 94 2e-20 >gb|PIN22303.1| Mitochondrial import inner membrane translocase, subunit TIM23 [Handroanthus impetiginosus] Length = 191 Score = 117 bits (294), Expect = 1e-29 Identities = 52/62 (83%), Positives = 60/62 (96%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 PQAPNQSNT+D+S+SNRRLYNPYQDLHLP +T+YNLP+SPEFLFQEE+ AQRRSWGENLT Sbjct: 5 PQAPNQSNTSDESNSNRRLYNPYQDLHLPAQTLYNLPTSPEFLFQEEAHAQRRSWGENLT 64 Query: 605 YY 610 +Y Sbjct: 65 FY 66 >ref|XP_011072553.1| mitochondrial import inner membrane translocase subunit TIM23-1 [Sesamum indicum] Length = 191 Score = 116 bits (290), Expect = 5e-29 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P+APNQ N+ D+S+SNRRLYNPYQDLHLPT+T+YNLP+SPEFLFQEE+ AQRRSWGENLT Sbjct: 5 PRAPNQGNSADESNSNRRLYNPYQDLHLPTQTLYNLPTSPEFLFQEEAHAQRRSWGENLT 64 Query: 605 YY 610 YY Sbjct: 65 YY 66 >ref|XP_012856473.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1 [Erythranthe guttata] gb|EYU21349.1| hypothetical protein MIMGU_mgv1a014438mg [Erythranthe guttata] Length = 189 Score = 113 bits (282), Expect = 7e-28 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P+ PNQSN D+SSSNRRLYNPYQDLHLP KT+YNLP+SPEFLFQEE++AQRRSWGENLT Sbjct: 5 PKDPNQSN--DESSSNRRLYNPYQDLHLPAKTLYNLPTSPEFLFQEEAVAQRRSWGENLT 62 Query: 605 YY 610 YY Sbjct: 63 YY 64 >gb|PIN14647.1| Mitochondrial import inner membrane translocase, subunit TIM23 [Handroanthus impetiginosus] Length = 191 Score = 112 bits (280), Expect = 1e-27 Identities = 50/62 (80%), Positives = 57/62 (91%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P+AP+QS D ++SNRRLYNPYQDLHLPT+T YNLPSSPEFLFQEE++AQRRSWGENLT Sbjct: 5 PRAPDQSAAPDDNNSNRRLYNPYQDLHLPTRTSYNLPSSPEFLFQEEALAQRRSWGENLT 64 Query: 605 YY 610 YY Sbjct: 65 YY 66 >ref|XP_011079930.1| mitochondrial import inner membrane translocase subunit TIM23-1-like [Sesamum indicum] Length = 191 Score = 112 bits (279), Expect = 2e-27 Identities = 49/62 (79%), Positives = 59/62 (95%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P+AP+ S+ TD++S NRRLYNPYQDL+LPT+T+YNLP+SPEFLFQEES+AQRRSWGENLT Sbjct: 5 PRAPDHSSATDENSRNRRLYNPYQDLNLPTQTLYNLPTSPEFLFQEESLAQRRSWGENLT 64 Query: 605 YY 610 YY Sbjct: 65 YY 66 >ref|XP_012836514.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Erythranthe guttata] gb|EYU45872.1| hypothetical protein MIMGU_mgv1a027042mg [Erythranthe guttata] Length = 191 Score = 110 bits (276), Expect = 6e-27 Identities = 49/62 (79%), Positives = 57/62 (91%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P+APN S+ +D++ SNRRLYNPYQDL LP KT+YNLP+SPEFLFQEE+IAQRRSWGENLT Sbjct: 5 PRAPNHSSGSDENESNRRLYNPYQDLRLPAKTLYNLPTSPEFLFQEEAIAQRRSWGENLT 64 Query: 605 YY 610 YY Sbjct: 65 YY 66 >ref|XP_019266067.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Nicotiana attenuata] gb|OIT35278.1| mitochondrial import inner membrane translocase subunit tim23-2 [Nicotiana attenuata] Length = 190 Score = 98.6 bits (244), Expect = 3e-22 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+PN + D NRRLYNPYQDLH+P +T+Y LP+SPEFLFQEES+AQRRSWGENLTY Sbjct: 6 QSPNHNGEND-DGQNRRLYNPYQDLHVPIQTLYKLPTSPEFLFQEESVAQRRSWGENLTY 64 Query: 608 Y 610 Y Sbjct: 65 Y 65 >ref|XP_009795181.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Nicotiana sylvestris] ref|XP_016447297.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Nicotiana tabacum] Length = 190 Score = 98.6 bits (244), Expect = 3e-22 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+PN + D NRRLYNPYQDLH+P +T+Y LP+SPEFLFQEES+AQRRSWGENLTY Sbjct: 6 QSPNHNGEND-DGQNRRLYNPYQDLHVPIQTLYKLPTSPEFLFQEESVAQRRSWGENLTY 64 Query: 608 Y 610 Y Sbjct: 65 Y 65 >ref|XP_009616035.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2 [Nicotiana tomentosiformis] Length = 190 Score = 98.6 bits (244), Expect = 3e-22 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+PN + D NRRLYNPYQDLH+P +T+Y LP+SPEFLFQEES+AQRRSWGENLTY Sbjct: 6 QSPNHNGEND-DGKNRRLYNPYQDLHVPIQTLYKLPTSPEFLFQEESVAQRRSWGENLTY 64 Query: 608 Y 610 Y Sbjct: 65 Y 65 >ref|XP_016510052.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-2-like [Nicotiana tabacum] Length = 195 Score = 98.6 bits (244), Expect = 4e-22 Identities = 44/61 (72%), Positives = 51/61 (83%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+PN + D NRRLYNPYQDLH+P +T+Y LP+SPEFLFQEES+AQRRSWGENLTY Sbjct: 6 QSPNHNGEND-DGKNRRLYNPYQDLHVPIQTLYKLPTSPEFLFQEESVAQRRSWGENLTY 64 Query: 608 Y 610 Y Sbjct: 65 Y 65 >ref|XP_006342960.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Solanum tuberosum] Length = 191 Score = 97.1 bits (240), Expect = 1e-21 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+PN + D NRRLYNPYQDL +P KT+Y LP+SPEFLFQEES+AQRRSWGENLTY Sbjct: 7 QSPNHTGDND-DGKNRRLYNPYQDLQVPIKTLYKLPTSPEFLFQEESVAQRRSWGENLTY 65 Query: 608 Y 610 Y Sbjct: 66 Y 66 >ref|XP_022844521.1| mitochondrial import inner membrane translocase subunit TIM23-2-like [Olea europaea var. sylvestris] Length = 190 Score = 95.9 bits (237), Expect = 4e-21 Identities = 44/62 (70%), Positives = 52/62 (83%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P+APN+ N D+S S RRLYNPYQDL +P +T+Y LP+SPE+LF EES AQRRSWGENLT Sbjct: 5 PRAPNERNG-DESDSTRRLYNPYQDLQIPAQTLYKLPTSPEYLFPEESRAQRRSWGENLT 63 Query: 605 YY 610 YY Sbjct: 64 YY 65 >ref|XP_015067553.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1 [Solanum pennellii] Length = 190 Score = 95.9 bits (237), Expect = 4e-21 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+PN + + NRRLYNPYQDL +P KT+Y LP+SPEFLFQEESIAQRRSWGENLTY Sbjct: 6 QSPNHTGDNE-DGKNRRLYNPYQDLQVPMKTLYKLPTSPEFLFQEESIAQRRSWGENLTY 64 Query: 608 Y 610 Y Sbjct: 65 Y 65 >ref|XP_021997078.1| mitochondrial import inner membrane translocase subunit TIM23-2-like [Helianthus annuus] Length = 187 Score = 95.5 bits (236), Expect = 5e-21 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P++PN + +S NRRLYNPYQDL++P +T+Y LP+SPE+LFQEESIAQRRSWGENLT Sbjct: 5 PRSPNPN----QSDENRRLYNPYQDLNIPAQTLYKLPTSPEYLFQEESIAQRRSWGENLT 60 Query: 605 YY 610 YY Sbjct: 61 YY 62 >gb|OTG04276.1| hypothetical protein HannXRQ_Chr12g0360471 [Helianthus annuus] Length = 201 Score = 95.5 bits (236), Expect = 7e-21 Identities = 43/62 (69%), Positives = 53/62 (85%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P++PN + +S NRRLYNPYQDL++P +T+Y LP+SPE+LFQEESIAQRRSWGENLT Sbjct: 5 PRSPNPN----QSDENRRLYNPYQDLNIPAQTLYKLPTSPEYLFQEESIAQRRSWGENLT 60 Query: 605 YY 610 YY Sbjct: 61 YY 62 >ref|XP_004235579.1| PREDICTED: mitochondrial import inner membrane translocase subunit TIM23-1-like [Solanum lycopersicum] Length = 190 Score = 95.1 bits (235), Expect = 7e-21 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q+ N + D NRRLYNPYQDL +P+KT+Y LP+SPEFLFQEESIAQRRSWGENLTY Sbjct: 6 QSSNHTGDND-DGKNRRLYNPYQDLQVPSKTLYKLPTSPEFLFQEESIAQRRSWGENLTY 64 Query: 608 Y 610 Y Sbjct: 65 Y 65 >gb|KVH92977.1| Mitochondrial inner membrane translocase subunit Tim17/Tim22/Tim23/peroxisomal protein PMP24 [Cynara cardunculus var. scolymus] Length = 190 Score = 94.7 bits (234), Expect = 1e-20 Identities = 43/62 (69%), Positives = 51/62 (82%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P++ N N TD NRRLYNPYQDL +P +T+Y LP+SPE+LFQEES+AQRRSWGENLT Sbjct: 5 PRSSNH-NETDDDRHNRRLYNPYQDLGVPVQTLYKLPTSPEYLFQEESVAQRRSWGENLT 63 Query: 605 YY 610 YY Sbjct: 64 YY 65 >ref|XP_023758865.1| mitochondrial import inner membrane translocase subunit TIM23-1-like [Lactuca sativa] gb|PLY89175.1| hypothetical protein LSAT_3X15620 [Lactuca sativa] Length = 190 Score = 94.4 bits (233), Expect = 1e-20 Identities = 43/62 (69%), Positives = 51/62 (82%) Frame = +2 Query: 425 PQAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLT 604 P++ N N +D NRRLYNPYQDL +P +T+Y LP+SPE+LFQEESIAQRRSWGENLT Sbjct: 5 PRSSNH-NESDDHHDNRRLYNPYQDLRVPAQTLYKLPTSPEYLFQEESIAQRRSWGENLT 63 Query: 605 YY 610 YY Sbjct: 64 YY 65 >ref|XP_021989967.1| mitochondrial import inner membrane translocase subunit TIM23-1-like [Helianthus annuus] gb|OTG12687.1| putative translocase inner membrane subunit 23-2 [Helianthus annuus] Length = 187 Score = 94.0 bits (232), Expect = 2e-20 Identities = 44/61 (72%), Positives = 50/61 (81%) Frame = +2 Query: 428 QAPNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTY 607 Q P+ N +D+ N RLYNPYQDL LP +TVY LP+SP+FLFQEESIAQRRSWGENLTY Sbjct: 5 QKPSNHNQSDE---NNRLYNPYQDLKLPAQTVYKLPTSPQFLFQEESIAQRRSWGENLTY 61 Query: 608 Y 610 Y Sbjct: 62 Y 62 >ref|XP_022889609.1| mitochondrial import inner membrane translocase subunit TIM23-1-like [Olea europaea var. sylvestris] Length = 191 Score = 94.0 bits (232), Expect = 2e-20 Identities = 42/60 (70%), Positives = 49/60 (81%) Frame = +2 Query: 431 APNQSNTTDKSSSNRRLYNPYQDLHLPTKTVYNLPSSPEFLFQEESIAQRRSWGENLTYY 610 AP + + D S SNRRLYNPYQDL +P +T+Y LP+SPE+LF EES AQRRSWGENLTYY Sbjct: 7 APKHNTSHDDSESNRRLYNPYQDLQVPIQTLYKLPTSPEYLFPEESHAQRRSWGENLTYY 66