BLASTX nr result
ID: Rehmannia29_contig00004534
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00004534 (554 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011072674.1| phosphoinositide phosphatase SAC2 [Sesamum i... 75 3e-12 gb|EYU21284.1| hypothetical protein MIMGU_mgv1a001500mg [Erythra... 72 3e-11 ref|XP_012856388.1| PREDICTED: phosphoinositide phosphatase SAC2... 72 3e-11 >ref|XP_011072674.1| phosphoinositide phosphatase SAC2 [Sesamum indicum] Length = 826 Score = 74.7 bits (182), Expect = 3e-12 Identities = 33/41 (80%), Positives = 36/41 (87%) Frame = +1 Query: 28 LKGKELASGDLSDGAACSSNDLAGFSQRFVHWVNHGDMLFP 150 +KGKELASGDLS ACSSNDL GFS+ FVHWVNHG+MLFP Sbjct: 786 MKGKELASGDLSYSGACSSNDLTGFSETFVHWVNHGNMLFP 826 >gb|EYU21284.1| hypothetical protein MIMGU_mgv1a001500mg [Erythranthe guttata] Length = 807 Score = 72.0 bits (175), Expect = 3e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 28 LKGKELASGDLSDGAACSSNDLAGFSQRFVHWVNHGDMLFP 150 LKGKELASGDLSDG A SSNDL+GFS+ FV+WVN+GD LFP Sbjct: 767 LKGKELASGDLSDGGASSSNDLSGFSEEFVNWVNYGDGLFP 807 >ref|XP_012856388.1| PREDICTED: phosphoinositide phosphatase SAC2-like [Erythranthe guttata] Length = 810 Score = 72.0 bits (175), Expect = 3e-11 Identities = 33/41 (80%), Positives = 37/41 (90%) Frame = +1 Query: 28 LKGKELASGDLSDGAACSSNDLAGFSQRFVHWVNHGDMLFP 150 LKGKELASGDLSDG A SSNDL+GFS+ FV+WVN+GD LFP Sbjct: 770 LKGKELASGDLSDGGASSSNDLSGFSEEFVNWVNYGDGLFP 810