BLASTX nr result
ID: Rehmannia29_contig00003572
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00003572 (482 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18949.1| hypothetical protein CDL12_08352 [Handroanthus im... 69 8e-12 ref|XP_011090386.1| zinc finger A20 and AN1 domain-containing st... 68 2e-11 ref|XP_011080262.1| zinc finger A20 and AN1 domain-containing st... 67 5e-11 ref|XP_012829814.1| PREDICTED: zinc finger A20 and AN1 domain-co... 63 2e-09 gb|KZV56450.1| outer envelope protein 80, chloroplastic-like [Do... 64 8e-09 ref|XP_019253711.1| PREDICTED: zinc finger A20 and AN1 domain-co... 56 2e-06 ref|XP_016510455.1| PREDICTED: zinc finger A20 and AN1 domain-co... 56 2e-06 ref|XP_016468512.1| PREDICTED: zinc finger AN1 domain-containing... 56 2e-06 ref|XP_009765432.1| PREDICTED: zinc finger A20 and AN1 domain-co... 56 2e-06 ref|XP_018631326.1| PREDICTED: zinc finger A20 and AN1 domain-co... 54 9e-06 ref|XP_009618607.1| PREDICTED: zinc finger A20 and AN1 domain-co... 54 1e-05 >gb|PIN18949.1| hypothetical protein CDL12_08352 [Handroanthus impetiginosus] Length = 142 Score = 68.9 bits (167), Expect = 8e-12 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPAARS 2 MAQ REKEETELKVPENLPICT Q + +PPPQLPAARS Sbjct: 1 MAQNREKEETELKVPENLPICTPPQTVPAPPPQLPAARS 39 >ref|XP_011090386.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 143 Score = 67.8 bits (164), Expect = 2e-11 Identities = 33/39 (84%), Positives = 33/39 (84%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPAARS 2 MAQKREKEETELKVPENLP CT QAI PPPQLP ARS Sbjct: 1 MAQKREKEETELKVPENLPRCTPSQAIPPPPPQLPPARS 39 >ref|XP_011080262.1| zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Sesamum indicum] Length = 147 Score = 67.0 bits (162), Expect = 5e-11 Identities = 32/39 (82%), Positives = 34/39 (87%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPAARS 2 MAQKR+KEETELKVPENLPICT Q + SP PQLPAARS Sbjct: 1 MAQKRDKEETELKVPENLPICTPPQTLPSPHPQLPAARS 39 >ref|XP_012829814.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Erythranthe guttata] gb|EYU46288.1| hypothetical protein MIMGU_mgv1a015852mg [Erythranthe guttata] Length = 143 Score = 62.8 bits (151), Expect = 2e-09 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPAARS 2 MAQKR+KEETELKVPEN+PICT Q I SPPPQ+P+ RS Sbjct: 1 MAQKRDKEETELKVPENIPICTPPQTI-SPPPQIPSTRS 38 >gb|KZV56450.1| outer envelope protein 80, chloroplastic-like [Dorcoceras hygrometricum] Length = 851 Score = 63.9 bits (154), Expect = 8e-09 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 121 NMAQKREKEETELKVPENLPICTSLQAISSPPPQLPAAR 5 +MAQKREKEETELKVPE+LPIC+ Q IS+PPP +PA+R Sbjct: 709 DMAQKREKEETELKVPESLPICSPPQPISTPPPHVPASR 747 >ref|XP_019253711.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana attenuata] gb|OIS98931.1| zinc finger a20 and an1 domain-containing stress-associated protein 5 [Nicotiana attenuata] Length = 204 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/37 (67%), Positives = 30/37 (81%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPAA 8 MAQKREKEETELKVPE++P+C+ IS+PPP L A Sbjct: 1 MAQKREKEETELKVPESIPLCSPALPISAPPPHLSTA 37 >ref|XP_016510455.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tabacum] Length = 205 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPA 11 MAQKREKEETELKVPE++P+C+ IS+PPP L A Sbjct: 1 MAQKREKEETELKVPESIPLCSPTLPISAPPPHLSA 36 >ref|XP_016468512.1| PREDICTED: zinc finger AN1 domain-containing stress-associated protein 15-like [Nicotiana tabacum] Length = 226 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPA 11 MAQKREKEETELKVPE++P+C+ IS+PPP L A Sbjct: 1 MAQKREKEETELKVPESIPLCSPTLPISAPPPHLSA 36 >ref|XP_009765432.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 6-like [Nicotiana sylvestris] Length = 226 Score = 55.8 bits (133), Expect = 2e-06 Identities = 25/36 (69%), Positives = 30/36 (83%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPA 11 MAQKREKEETELKVPE++P+C+ IS+PPP L A Sbjct: 1 MAQKREKEETELKVPESIPLCSPTLPISAPPPHLSA 36 >ref|XP_018631326.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform X2 [Nicotiana tomentosiformis] Length = 193 Score = 53.9 bits (128), Expect = 9e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPA 11 MAQKREKEE ELKVPE++P+C+ IS+PPP L A Sbjct: 1 MAQKREKEEAELKVPESIPLCSPTLPISAPPPHLSA 36 >ref|XP_009618607.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like isoform X1 [Nicotiana tomentosiformis] ref|XP_016474769.1| PREDICTED: zinc finger A20 and AN1 domain-containing stress-associated protein 5-like [Nicotiana tabacum] Length = 205 Score = 53.9 bits (128), Expect = 1e-05 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = -2 Query: 118 MAQKREKEETELKVPENLPICTSLQAISSPPPQLPA 11 MAQKREKEE ELKVPE++P+C+ IS+PPP L A Sbjct: 1 MAQKREKEEAELKVPESIPLCSPTLPISAPPPHLSA 36