BLASTX nr result
ID: Rehmannia29_contig00002844
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00002844 (453 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN18338.1| Cytochrome c oxidase assembly protein/Cu2+ chaper... 69 2e-12 ref|XP_020554450.1| cytochrome c oxidase copper chaperone 2 [Ses... 66 2e-11 ref|XP_011082676.1| cytochrome c oxidase copper chaperone 1 [Ses... 62 9e-10 gb|KZV23225.1| cytochrome c oxidase copper chaperone 1-like [Dor... 61 1e-09 emb|CDP05919.1| unnamed protein product [Coffea canephora] 60 4e-09 ref|XP_022854605.1| cytochrome c oxidase copper chaperone 2-like... 55 2e-07 gb|PIN22743.1| Cytochrome c oxidase assembly protein/Cu2+ chaper... 55 4e-07 >gb|PIN18338.1| Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17 [Handroanthus impetiginosus] Length = 79 Score = 68.6 bits (166), Expect = 2e-12 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQGPTSVSSGPDSKPKKRICCA 174 MGG+PIQSS VIS+QSQKD+G T V+SGPD KPKKRICCA Sbjct: 1 MGGLPIQSSSSVISVQSQKDKGSTIVASGPDLKPKKRICCA 41 >ref|XP_020554450.1| cytochrome c oxidase copper chaperone 2 [Sesamum indicum] ref|XP_020554451.1| cytochrome c oxidase copper chaperone 2 [Sesamum indicum] ref|XP_020554452.1| cytochrome c oxidase copper chaperone 2 [Sesamum indicum] Length = 79 Score = 65.9 bits (159), Expect = 2e-11 Identities = 30/41 (73%), Positives = 36/41 (87%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQGPTSVSSGPDSKPKKRICCA 174 MGG+PIQ+S VISLQSQKDQ +V+SGPDSKP+K+ICCA Sbjct: 1 MGGLPIQNSSSVISLQSQKDQRSETVASGPDSKPRKKICCA 41 >ref|XP_011082676.1| cytochrome c oxidase copper chaperone 1 [Sesamum indicum] ref|XP_011082679.1| cytochrome c oxidase copper chaperone 1 [Sesamum indicum] Length = 80 Score = 61.6 bits (148), Expect = 9e-10 Identities = 29/42 (69%), Positives = 36/42 (85%), Gaps = 1/42 (2%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQ-GPTSVSSGPDSKPKKRICCA 174 MGG+ IQ+S ++SLQSQKDQ G T+V+S PDSKPKK+ICCA Sbjct: 1 MGGLSIQNSSSIVSLQSQKDQQGSTAVTSAPDSKPKKKICCA 42 >gb|KZV23225.1| cytochrome c oxidase copper chaperone 1-like [Dorcoceras hygrometricum] Length = 79 Score = 61.2 bits (147), Expect = 1e-09 Identities = 30/41 (73%), Positives = 32/41 (78%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQGPTSVSSGPDSKPKKRICCA 174 MG +P SS VISLQSQKD G SVSSG DSKPKK+ICCA Sbjct: 1 MGSVPSHSSSSVISLQSQKDLGSGSVSSGSDSKPKKKICCA 41 >emb|CDP05919.1| unnamed protein product [Coffea canephora] Length = 79 Score = 60.1 bits (144), Expect = 4e-09 Identities = 27/41 (65%), Positives = 31/41 (75%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQGPTSVSSGPDSKPKKRICCA 174 MGG+P Q+S VISL KDQ P SV GPDSKP+K+ICCA Sbjct: 1 MGGLPAQNSSSVISLNVHKDQSPGSVGPGPDSKPRKKICCA 41 >ref|XP_022854605.1| cytochrome c oxidase copper chaperone 2-like [Olea europaea var. sylvestris] Length = 78 Score = 55.5 bits (132), Expect = 2e-07 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQGPTSVSSGPDSKPKKRICCA 174 MGG+PIQ+S V+SLQSQKDQG V+ DSKPKK ICCA Sbjct: 1 MGGLPIQNSSSVVSLQSQKDQGSGIVTPASDSKPKK-ICCA 40 >gb|PIN22743.1| Cytochrome c oxidase assembly protein/Cu2+ chaperone COX17 [Handroanthus impetiginosus] Length = 79 Score = 54.7 bits (130), Expect = 4e-07 Identities = 25/41 (60%), Positives = 33/41 (80%) Frame = +1 Query: 52 MGGIPIQSSPLVISLQSQKDQGPTSVSSGPDSKPKKRICCA 174 MGG+PIQ+ VIS+QSQKD+ T+ +S +SKPKK+ICCA Sbjct: 1 MGGVPIQNLTSVISVQSQKDERSTAAASELNSKPKKKICCA 41