BLASTX nr result
ID: Rehmannia29_contig00002521
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00002521 (973 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN09659.1| hypothetical protein CDL12_17758 [Handroanthus im... 60 2e-06 ref|XP_011081843.1| DDT domain-containing protein DDR4 [Sesamum ... 60 3e-06 >gb|PIN09659.1| hypothetical protein CDL12_17758 [Handroanthus impetiginosus] Length = 477 Score = 60.5 bits (145), Expect = 2e-06 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -2 Query: 885 VYVFEPVIRSDMKILADDIETALIESNNTLAQLHIALLK 769 ++VFEPVI SD+KI A++IETALIE N+TLAQLHI LLK Sbjct: 47 LHVFEPVIESDLKISAEEIETALIEQNDTLAQLHIVLLK 85 >ref|XP_011081843.1| DDT domain-containing protein DDR4 [Sesamum indicum] Length = 486 Score = 60.1 bits (144), Expect = 3e-06 Identities = 30/39 (76%), Positives = 34/39 (87%) Frame = -2 Query: 885 VYVFEPVIRSDMKILADDIETALIESNNTLAQLHIALLK 769 ++VFEPVI SD+KI A+DIETALIE NN LAQLHI LLK Sbjct: 52 LHVFEPVIGSDLKISAEDIETALIEQNNILAQLHIDLLK 90