BLASTX nr result
ID: Rehmannia29_contig00002269
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00002269 (539 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012840776.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 77 5e-13 gb|KZV24818.1| glyoxysomal fatty acid beta-oxidation multifuncti... 76 8e-13 ref|XP_016506757.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 70 2e-12 ref|XP_011071437.1| glyoxysomal fatty acid beta-oxidation multif... 74 3e-12 gb|PIN12055.1| Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase... 74 6e-12 gb|PHT33187.1| Glyoxysomal fatty acid beta-oxidation multifuncti... 72 2e-11 dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation m... 72 2e-11 ref|XP_016550654.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 72 2e-11 ref|XP_016550653.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 72 2e-11 ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 70 1e-10 ref|XP_022878758.1| glyoxysomal fatty acid beta-oxidation multif... 70 1e-10 ref|XP_022850927.1| glyoxysomal fatty acid beta-oxidation multif... 69 3e-10 ref|XP_016508177.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ... 69 3e-10 ref|XP_022850926.1| glyoxysomal fatty acid beta-oxidation multif... 69 3e-10 ref|XP_019263551.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 69 3e-10 ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 69 3e-10 ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 66 3e-09 gb|KZM85519.1| hypothetical protein DCAR_027059 [Daucus carota s... 65 4e-09 ref|XP_017222695.1| PREDICTED: glyoxysomal fatty acid beta-oxida... 65 4e-09 ref|XP_008368358.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal ... 61 8e-09 >ref|XP_012840776.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Erythranthe guttata] gb|EYU45545.1| hypothetical protein MIMGU_mgv1a002038mg [Erythranthe guttata] Length = 724 Score = 76.6 bits (187), Expect = 5e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPCSYLAERAAKGAPLSLTVDP KSRL Sbjct: 688 EWSNLYGGFFKPCSYLAERAAKGAPLSLTVDPTKSRL 724 >gb|KZV24818.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Dorcoceras hygrometricum] Length = 748 Score = 76.3 bits (186), Expect = 8e-13 Identities = 35/37 (94%), Positives = 35/37 (94%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPCSYLA RAAKGAPLSLTVDPAKSRL Sbjct: 712 EWSNKYGGFFKPCSYLAGRAAKGAPLSLTVDPAKSRL 748 >ref|XP_016506757.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Nicotiana tabacum] Length = 96 Score = 70.1 bits (170), Expect = 2e-12 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLS T+DPAKSRL Sbjct: 60 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPAKSRL 96 >ref|XP_011071437.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Sesamum indicum] Length = 724 Score = 74.3 bits (181), Expect = 3e-12 Identities = 34/37 (91%), Positives = 34/37 (91%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS SYGGFFKPCSYLAERAAKGAPLSL DPAKSRL Sbjct: 688 EWSKSYGGFFKPCSYLAERAAKGAPLSLMTDPAKSRL 724 >gb|PIN12055.1| Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Handroanthus impetiginosus] Length = 724 Score = 73.6 bits (179), Expect = 6e-12 Identities = 33/37 (89%), Positives = 35/37 (94%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS SYGGFFKPCSYLA+RAAKGAPLSLT+D AKSRL Sbjct: 688 EWSKSYGGFFKPCSYLADRAAKGAPLSLTIDTAKSRL 724 >gb|PHT33187.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Capsicum baccatum] Length = 725 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKSRL Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKSRL 725 >dbj|BAG16526.1| putative glyoxysomal fatty acid beta-oxidation multifunctional protein [Capsicum chinense] gb|PHU01746.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Capsicum chinense] Length = 725 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKSRL Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKSRL 725 >ref|XP_016550654.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a isoform X2 [Capsicum annuum] gb|PHT66951.1| Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Capsicum annuum] Length = 725 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKSRL Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKSRL 725 >ref|XP_016550653.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a isoform X1 [Capsicum annuum] Length = 727 Score = 72.0 bits (175), Expect = 2e-11 Identities = 33/37 (89%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLSLT DPAKSRL Sbjct: 691 EWSRMYGDFFKPCSYLAERAAKGAPLSLTTDPAKSRL 727 >ref|XP_009622777.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Nicotiana tomentosiformis] Length = 725 Score = 70.1 bits (170), Expect = 1e-10 Identities = 32/37 (86%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLS T+DPAKSRL Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPAKSRL 725 >ref|XP_022878758.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Olea europaea var. sylvestris] Length = 724 Score = 69.7 bits (169), Expect = 1e-10 Identities = 31/37 (83%), Positives = 35/37 (94%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPCSYLA++AAKGAPLSL+VD AK+RL Sbjct: 688 EWSNLYGGFFKPCSYLAQQAAKGAPLSLSVDQAKARL 724 >ref|XP_022850927.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like isoform X2 [Olea europaea var. sylvestris] Length = 680 Score = 68.9 bits (167), Expect = 3e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPCSYLA+RAAKGA LS +VDPAK+RL Sbjct: 644 EWSNLYGGFFKPCSYLAQRAAKGATLSSSVDPAKARL 680 >ref|XP_016508177.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Nicotiana tabacum] Length = 702 Score = 68.9 bits (167), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLS T+DP+KSRL Sbjct: 666 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPSKSRL 702 >ref|XP_022850926.1| glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like isoform X1 [Olea europaea var. sylvestris] Length = 724 Score = 68.9 bits (167), Expect = 3e-10 Identities = 31/37 (83%), Positives = 34/37 (91%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPCSYLA+RAAKGA LS +VDPAK+RL Sbjct: 688 EWSNLYGGFFKPCSYLAQRAAKGATLSSSVDPAKARL 724 >ref|XP_019263551.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Nicotiana attenuata] gb|OIT37053.1| glyoxysomal fatty acid beta-oxidation multifunctional protein mfp-a [Nicotiana attenuata] Length = 725 Score = 68.9 bits (167), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLS T+DP+KSRL Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPSKSRL 725 >ref|XP_009769326.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Nicotiana sylvestris] Length = 725 Score = 68.9 bits (167), Expect = 3e-10 Identities = 31/37 (83%), Positives = 33/37 (89%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERAAKGAPLS T+DP+KSRL Sbjct: 689 EWSRMYGDFFKPCSYLAERAAKGAPLSSTMDPSKSRL 725 >ref|XP_006349823.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Solanum tuberosum] Length = 727 Score = 65.9 bits (159), Expect = 3e-09 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWS YG FFKPCSYLAERA+KGAPLS T D AKSRL Sbjct: 691 EWSRMYGDFFKPCSYLAERASKGAPLSATTDSAKSRL 727 >gb|KZM85519.1| hypothetical protein DCAR_027059 [Daucus carota subsp. sativus] Length = 711 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPC+YLAE+AAKGAPLS +D K+RL Sbjct: 675 EWSNKYGGFFKPCAYLAEKAAKGAPLSTPLDQGKARL 711 >ref|XP_017222695.1| PREDICTED: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a [Daucus carota subsp. sativus] Length = 720 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN YGGFFKPC+YLAE+AAKGAPLS +D K+RL Sbjct: 684 EWSNKYGGFFKPCAYLAEKAAKGAPLSTPLDQGKARL 720 >ref|XP_008368358.1| PREDICTED: LOW QUALITY PROTEIN: glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a-like [Malus domestica] Length = 130 Score = 61.2 bits (147), Expect = 8e-09 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = +1 Query: 1 EWSNSYGGFFKPCSYLAERAAKGAPLSLTVDPAKSRL 111 EWSN+YG FFKPC+YLAERAA GAPLS + AKSRL Sbjct: 60 EWSNTYGEFFKPCAYLAERAANGAPLSSQSNQAKSRL 96