BLASTX nr result
ID: Rehmannia29_contig00002265
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00002265 (885 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001267649.1| hypersensitive-induced response protein 1-li... 79 4e-13 ref|XP_023537068.1| hypersensitive-induced response protein 2 [C... 79 4e-13 ref|XP_023002105.1| hypersensitive-induced response protein 2 [C... 79 4e-13 ref|XP_022951590.1| hypersensitive-induced response protein 1 [C... 79 4e-13 ref|XP_022951584.1| hypersensitive-induced response protein 2-li... 79 4e-13 ref|XP_022151314.1| hypersensitive-induced response protein 1 [M... 79 4e-13 gb|OWM75979.1| hypothetical protein CDL15_Pgr009624 [Punica gran... 79 4e-13 ref|XP_008456463.1| PREDICTED: hypersensitive-induced response p... 79 4e-13 gb|ABF50560.1| salinity-induced protein, partial [Alternanthera ... 75 6e-13 ref|XP_023002098.1| hypersensitive-induced response protein 2-li... 77 1e-12 gb|KDO82794.1| hypothetical protein CISIN_1g0229931mg, partial [... 74 2e-12 ref|XP_022889108.1| hypersensitive-induced response protein-like... 77 2e-12 gb|PIA62515.1| hypothetical protein AQUCO_00200493v1 [Aquilegia ... 77 2e-12 gb|PIA62516.1| hypothetical protein AQUCO_00200493v1 [Aquilegia ... 77 2e-12 gb|KDO82795.1| hypothetical protein CISIN_1g0229931mg, partial [... 75 3e-12 gb|KZV33130.1| hypersensitive-induced response protein 1-like [D... 74 4e-12 ref|XP_010242358.1| PREDICTED: hypersensitive-induced response p... 75 5e-12 ref|XP_010256425.1| PREDICTED: hypersensitive-induced response p... 75 5e-12 gb|KQL01675.1| hypothetical protein SETIT_014212mg [Setaria ital... 74 6e-12 gb|KJB70935.1| hypothetical protein B456_011G096600 [Gossypium r... 75 6e-12 >ref|NP_001267649.1| hypersensitive-induced response protein 1-like [Cucumis sativus] ref|XP_011656302.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X1 [Cucumis sativus] ref|XP_011656303.1| PREDICTED: hypersensitive-induced response protein 1-like isoform X1 [Cucumis sativus] gb|AAQ72788.1| hypersensitive-induced response protein [Cucumis sativus] gb|KGN47806.1| hypothetical protein Csa_6G404210 [Cucumis sativus] Length = 284 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >ref|XP_023537068.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537069.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537071.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537072.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537073.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537074.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537075.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] ref|XP_023537076.1| hypersensitive-induced response protein 2 [Cucurbita pepo subsp. pepo] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >ref|XP_023002105.1| hypersensitive-induced response protein 2 [Cucurbita maxima] ref|XP_023002106.1| hypersensitive-induced response protein 2 [Cucurbita maxima] ref|XP_023002107.1| hypersensitive-induced response protein 2 [Cucurbita maxima] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >ref|XP_022951590.1| hypersensitive-induced response protein 1 [Cucurbita moschata] ref|XP_022951591.1| hypersensitive-induced response protein 1 [Cucurbita moschata] ref|XP_022951592.1| hypersensitive-induced response protein 1 [Cucurbita moschata] ref|XP_022951593.1| hypersensitive-induced response protein 1 [Cucurbita moschata] ref|XP_023537077.1| hypersensitive-induced response protein 1 [Cucurbita pepo subsp. pepo] ref|XP_023537078.1| hypersensitive-induced response protein 1 [Cucurbita pepo subsp. pepo] ref|XP_023537079.1| hypersensitive-induced response protein 1 [Cucurbita pepo subsp. pepo] ref|XP_023537081.1| hypersensitive-induced response protein 1 [Cucurbita pepo subsp. pepo] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >ref|XP_022951584.1| hypersensitive-induced response protein 2-like [Cucurbita moschata] ref|XP_022951585.1| hypersensitive-induced response protein 2-like [Cucurbita moschata] ref|XP_022951586.1| hypersensitive-induced response protein 2-like [Cucurbita moschata] ref|XP_022951587.1| hypersensitive-induced response protein 2-like [Cucurbita moschata] ref|XP_022951588.1| hypersensitive-induced response protein 2-like [Cucurbita moschata] ref|XP_022951589.1| hypersensitive-induced response protein 2-like [Cucurbita moschata] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >ref|XP_022151314.1| hypersensitive-induced response protein 1 [Momordica charantia] ref|XP_022151315.1| hypersensitive-induced response protein 1 [Momordica charantia] ref|XP_022151317.1| hypersensitive-induced response protein 1 [Momordica charantia] ref|XP_022151318.1| hypersensitive-induced response protein 1 [Momordica charantia] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >gb|OWM75979.1| hypothetical protein CDL15_Pgr009624 [Punica granatum] gb|PKI41305.1| hypothetical protein CRG98_038326 [Punica granatum] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >ref|XP_008456463.1| PREDICTED: hypersensitive-induced response protein 2 [Cucumis melo] ref|XP_008456464.1| PREDICTED: hypersensitive-induced response protein 2 [Cucumis melo] ref|XP_008456466.1| PREDICTED: hypersensitive-induced response protein 2 [Cucumis melo] Length = 285 Score = 78.6 bits (192), Expect = 4e-13 Identities = 39/39 (100%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 142 >gb|ABF50560.1| salinity-induced protein, partial [Alternanthera philoxeroides] Length = 135 Score = 74.7 bits (182), Expect = 6e-13 Identities = 37/39 (94%), Positives = 38/39 (97%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDS+FEQKNDIAKAVE ELEKAMSAYGYE Sbjct: 52 VIRASVPKLDLDSSFEQKNDIAKAVEQELEKAMSAYGYE 90 >ref|XP_023002098.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] ref|XP_023002099.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] ref|XP_023002100.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] ref|XP_023002101.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] ref|XP_023002102.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] ref|XP_023002103.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] ref|XP_023002104.1| hypersensitive-induced response protein 2-like [Cucurbita maxima] Length = 285 Score = 77.0 bits (188), Expect = 1e-12 Identities = 38/39 (97%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYG+E Sbjct: 104 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGFE 142 >gb|KDO82794.1| hypothetical protein CISIN_1g0229931mg, partial [Citrus sinensis] Length = 131 Score = 73.6 bits (179), Expect = 2e-12 Identities = 36/39 (92%), Positives = 38/39 (97%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLD+TFEQKNDIAKAVE+ELEKAMS YGYE Sbjct: 41 VIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYE 79 >ref|XP_022889108.1| hypersensitive-induced response protein-like protein 2 [Olea europaea var. sylvestris] Length = 293 Score = 77.0 bits (188), Expect = 2e-12 Identities = 37/42 (88%), Positives = 41/42 (97%) Frame = -2 Query: 128 ECLVIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 + LVIRAS+P+LDLDSTFEQKNDIAKAVE+ELEKAMSAYGYE Sbjct: 108 DTLVIRASIPRLDLDSTFEQKNDIAKAVENELEKAMSAYGYE 149 >gb|PIA62515.1| hypothetical protein AQUCO_00200493v1 [Aquilegia coerulea] Length = 274 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMS YGYE Sbjct: 91 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSLYGYE 129 >gb|PIA62516.1| hypothetical protein AQUCO_00200493v1 [Aquilegia coerulea] gb|PIA62517.1| hypothetical protein AQUCO_00200493v1 [Aquilegia coerulea] Length = 286 Score = 76.6 bits (187), Expect = 2e-12 Identities = 38/39 (97%), Positives = 38/39 (97%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMS YGYE Sbjct: 103 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSLYGYE 141 >gb|KDO82795.1| hypothetical protein CISIN_1g0229931mg, partial [Citrus sinensis] Length = 235 Score = 75.1 bits (183), Expect = 3e-12 Identities = 37/40 (92%), Positives = 39/40 (97%) Frame = -2 Query: 122 LVIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 LVIRASVPKLDLD+TFEQKNDIAKAVE+ELEKAMS YGYE Sbjct: 53 LVIRASVPKLDLDATFEQKNDIAKAVEEELEKAMSHYGYE 92 >gb|KZV33130.1| hypersensitive-induced response protein 1-like [Dorcoceras hygrometricum] Length = 186 Score = 73.9 bits (180), Expect = 4e-12 Identities = 36/40 (90%), Positives = 39/40 (97%) Frame = -2 Query: 122 LVIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 +VIRASVPKL+LDS FEQKNDIAKAVEDELEKAMSAYG+E Sbjct: 4 VVIRASVPKLELDSAFEQKNDIAKAVEDELEKAMSAYGFE 43 >ref|XP_010242358.1| PREDICTED: hypersensitive-induced response protein 1-like [Nelumbo nucifera] ref|XP_010242359.1| PREDICTED: hypersensitive-induced response protein 1-like [Nelumbo nucifera] Length = 285 Score = 75.5 bits (184), Expect = 5e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKN+IAKAVE+ELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNEIAKAVEEELEKAMSAYGYE 142 >ref|XP_010256425.1| PREDICTED: hypersensitive-induced response protein 1-like [Nelumbo nucifera] Length = 286 Score = 75.5 bits (184), Expect = 5e-12 Identities = 37/39 (94%), Positives = 39/39 (100%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLDSTFEQKN+IAKAVE+ELEKAMSAYGYE Sbjct: 104 VIRASVPKLDLDSTFEQKNEIAKAVEEELEKAMSAYGYE 142 >gb|KQL01675.1| hypothetical protein SETIT_014212mg [Setaria italica] Length = 191 Score = 73.6 bits (179), Expect = 6e-12 Identities = 35/41 (85%), Positives = 38/41 (92%) Frame = -2 Query: 125 CLVIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 C VIRASVPK++LD TFEQKN+IAKAVEDELEKAMS YGYE Sbjct: 9 CSVIRASVPKMNLDDTFEQKNEIAKAVEDELEKAMSMYGYE 49 >gb|KJB70935.1| hypothetical protein B456_011G096600 [Gossypium raimondii] Length = 274 Score = 75.1 bits (183), Expect = 6e-12 Identities = 37/39 (94%), Positives = 37/39 (94%) Frame = -2 Query: 119 VIRASVPKLDLDSTFEQKNDIAKAVEDELEKAMSAYGYE 3 VIRASVPKLDLD FEQKNDIAKAVEDELEKAMSAYGYE Sbjct: 92 VIRASVPKLDLDDAFEQKNDIAKAVEDELEKAMSAYGYE 130