BLASTX nr result
ID: Rehmannia29_contig00002228
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00002228 (432 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PHT79881.1| hypothetical protein T459_17933 [Capsicum annuum] 79 2e-14 ref|XP_019195559.1| PREDICTED: heat stress transcription factor ... 77 2e-13 emb|CBI26502.3| unnamed protein product, partial [Vitis vinifera] 71 2e-13 gb|PIN23514.1| Heat shock transcription factor [Handroanthus imp... 76 2e-13 ref|XP_022893694.1| heat shock factor protein HSF8-like [Olea eu... 75 8e-13 gb|EPS69073.1| hypothetical protein M569_05693, partial [Genlise... 74 1e-12 ref|XP_016564127.1| PREDICTED: heat stress transcription factor ... 74 1e-12 ref|XP_022640423.1| heat stress transcription factor A-7a [Vigna... 74 1e-12 gb|PIA42993.1| hypothetical protein AQUCO_02000446v1 [Aquilegia ... 74 1e-12 ref|XP_023540455.1| heat shock factor protein HSF8-like [Cucurbi... 74 2e-12 ref|XP_017413704.1| PREDICTED: heat stress transcription factor ... 74 2e-12 emb|CDM84939.1| unnamed protein product [Triticum aestivum] 74 2e-12 ref|XP_020187935.1| heat stress transcription factor A-2b-like [... 74 2e-12 ref|XP_019240189.1| PREDICTED: heat stress transcription factor ... 74 2e-12 ref|XP_016439999.1| PREDICTED: heat stress transcription factor ... 74 2e-12 ref|XP_016465973.1| PREDICTED: heat stress transcription factor ... 74 2e-12 ref|XP_009790324.1| PREDICTED: heat stress transcription factor ... 74 2e-12 ref|XP_009623591.1| PREDICTED: heat stress transcription factor ... 74 2e-12 gb|PHT96884.1| Heat stress transcription factor A-1 [Capsicum ch... 74 2e-12 ref|XP_016564126.1| PREDICTED: heat stress transcription factor ... 74 2e-12 >gb|PHT79881.1| hypothetical protein T459_17933 [Capsicum annuum] Length = 463 Score = 79.3 bits (194), Expect = 2e-14 Identities = 39/58 (67%), Positives = 45/58 (77%), Gaps = 5/58 (8%) Frame = -2 Query: 218 VFRL-----YLKPQ*FFYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 VFRL Y+ FYSLLS F+N G++KVDPD WEFANEGFLRGHKHLLK+I+RR Sbjct: 29 VFRLQVLFAYVGQPYTFYSLLSPFINQGYKKVDPDSWEFANEGFLRGHKHLLKTISRR 86 >ref|XP_019195559.1| PREDICTED: heat stress transcription factor A-1b isoform X2 [Ipomoea nil] Length = 440 Score = 76.6 bits (187), Expect = 2e-13 Identities = 35/43 (81%), Positives = 36/43 (83%) Frame = -2 Query: 188 FFYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 FFYSLL GFRKVDPDRWEFANEGFLRGH+HLLKSI RR Sbjct: 9 FFYSLLFSLGKQGFRKVDPDRWEFANEGFLRGHRHLLKSITRR 51 >emb|CBI26502.3| unnamed protein product, partial [Vitis vinifera] Length = 97 Score = 71.2 bits (173), Expect = 2e-13 Identities = 36/52 (69%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = -2 Query: 203 LKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 L P+ F ++ S FV YGFRKVDPDRWEFANEGFLRG KHLLKSI+RR Sbjct: 32 LLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKSISRR 83 >gb|PIN23514.1| Heat shock transcription factor [Handroanthus impetiginosus] Length = 481 Score = 76.3 bits (186), Expect = 2e-13 Identities = 38/52 (73%), Positives = 41/52 (78%), Gaps = 4/52 (7%) Frame = -2 Query: 203 LKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 L P+ F ++ S FV YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR Sbjct: 59 LLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 110 >ref|XP_022893694.1| heat shock factor protein HSF8-like [Olea europaea var. sylvestris] Length = 533 Score = 74.7 bits (182), Expect = 8e-13 Identities = 38/56 (67%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = -2 Query: 215 FRLYLKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F YL P+ F ++ S FV YGFRKVDPDRWEFANEGFLRG KHLLKSI+RR Sbjct: 72 FARYLLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGKKHLLKSISRR 127 >gb|EPS69073.1| hypothetical protein M569_05693, partial [Genlisea aurea] Length = 463 Score = 74.3 bits (181), Expect = 1e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLK+INRR Sbjct: 56 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKNINRR 97 >ref|XP_016564127.1| PREDICTED: heat stress transcription factor A-1 isoform X2 [Capsicum annuum] gb|PHT87687.1| Heat stress transcription factor A-1 [Capsicum annuum] Length = 505 Score = 74.3 bits (181), Expect = 1e-12 Identities = 36/50 (72%), Positives = 41/50 (82%), Gaps = 4/50 (8%) Frame = -2 Query: 197 PQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 P+ F ++ S+FV YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 61 PKYFRHNNFSNFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 110 >ref|XP_022640423.1| heat stress transcription factor A-7a [Vigna radiata var. radiata] Length = 358 Score = 73.9 bits (180), Expect = 1e-12 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = -2 Query: 215 FRLYLKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F L P+ F +S S FV YGFRK+DPDRW+FANEGF+RGHKHLLKSI RR Sbjct: 79 FSAILLPRYFKHSNFSSFVRQLNTYGFRKIDPDRWQFANEGFIRGHKHLLKSIRRR 134 >gb|PIA42993.1| hypothetical protein AQUCO_02000446v1 [Aquilegia coerulea] Length = 383 Score = 73.9 bits (180), Expect = 1e-12 Identities = 36/56 (64%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = -2 Query: 215 FRLYLKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F ++L P+ F +S S F+ YGFRKVDPDRWEFANEGFLRG KHLLK+I RR Sbjct: 99 FSIHLLPKYFKHSNFSSFIRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTIKRR 154 >ref|XP_023540455.1| heat shock factor protein HSF8-like [Cucurbita pepo subsp. pepo] Length = 520 Score = 73.9 bits (180), Expect = 2e-12 Identities = 37/52 (71%), Positives = 40/52 (76%), Gaps = 4/52 (7%) Frame = -2 Query: 203 LKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 L P+ F ++ S FV YGFRKVDPDRWEFANEGFLRGHKHLLKSI RR Sbjct: 74 LLPKYFKHNNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSITRR 125 >ref|XP_017413704.1| PREDICTED: heat stress transcription factor A-7a-like [Vigna angularis] gb|KOM35067.1| hypothetical protein LR48_Vigan02g121700 [Vigna angularis] dbj|BAT95564.1| hypothetical protein VIGAN_08231700 [Vigna angularis var. angularis] Length = 356 Score = 73.6 bits (179), Expect = 2e-12 Identities = 36/56 (64%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = -2 Query: 215 FRLYLKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F L P+ F +S S FV YGFRK+DPDRW+FANEGF+RGHKHLLKSI RR Sbjct: 78 FSASLLPRYFKHSNFSSFVRQLNTYGFRKIDPDRWQFANEGFIRGHKHLLKSIRRR 133 >emb|CDM84939.1| unnamed protein product [Triticum aestivum] Length = 396 Score = 73.6 bits (179), Expect = 2e-12 Identities = 39/61 (63%), Positives = 43/61 (70%), Gaps = 4/61 (6%) Frame = -2 Query: 230 LHHLVFRLYLKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINR 63 LHH F L P+ F +S S FV YGFRKVDPDRWEFANEGFLRG +HLLK+I R Sbjct: 72 LHH--FSTVLLPRHFKHSNFSSFVKQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKNIRR 129 Query: 62 R 60 R Sbjct: 130 R 130 >ref|XP_020187935.1| heat stress transcription factor A-2b-like [Aegilops tauschii subsp. tauschii] Length = 397 Score = 73.6 bits (179), Expect = 2e-12 Identities = 39/61 (63%), Positives = 43/61 (70%), Gaps = 4/61 (6%) Frame = -2 Query: 230 LHHLVFRLYLKPQ*FFYSLLSHFVN----YGFRKVDPDRWEFANEGFLRGHKHLLKSINR 63 LHH F L P+ F +S S FV YGFRKVDPDRWEFANEGFLRG +HLLK+I R Sbjct: 73 LHH--FSTVLLPRHFKHSNFSSFVKQLNTYGFRKVDPDRWEFANEGFLRGQRHLLKNIRR 130 Query: 62 R 60 R Sbjct: 131 R 131 >ref|XP_019240189.1| PREDICTED: heat stress transcription factor A-1-like [Nicotiana attenuata] gb|OIT20426.1| heat stress transcription factor a-1 [Nicotiana attenuata] Length = 497 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 65 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 106 >ref|XP_016439999.1| PREDICTED: heat stress transcription factor A-1b-like [Nicotiana tabacum] Length = 497 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 65 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 106 >ref|XP_016465973.1| PREDICTED: heat stress transcription factor A-1b-like [Nicotiana tabacum] Length = 497 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 65 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 106 >ref|XP_009790324.1| PREDICTED: heat stress transcription factor A-1b [Nicotiana sylvestris] Length = 497 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 65 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 106 >ref|XP_009623591.1| PREDICTED: heat stress transcription factor A-1b [Nicotiana tomentosiformis] Length = 497 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 65 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 106 >gb|PHT96884.1| Heat stress transcription factor A-1 [Capsicum chinense] Length = 505 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 69 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 110 >ref|XP_016564126.1| PREDICTED: heat stress transcription factor A-1 isoform X1 [Capsicum annuum] Length = 505 Score = 73.6 bits (179), Expect = 2e-12 Identities = 33/42 (78%), Positives = 35/42 (83%) Frame = -2 Query: 185 FYSLLSHFVNYGFRKVDPDRWEFANEGFLRGHKHLLKSINRR 60 F S + YGFRKVDPDRWEFANEGFLRGHKHLLKSI+RR Sbjct: 69 FSSFVRQLNTYGFRKVDPDRWEFANEGFLRGHKHLLKSISRR 110