BLASTX nr result
ID: Rehmannia29_contig00002194
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00002194 (592 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN17282.1| hypothetical protein CDL12_10055 [Handroanthus im... 77 3e-13 ref|XP_012842474.1| PREDICTED: uncharacterized protein LOC105962... 70 6e-11 ref|XP_012842473.1| PREDICTED: uncharacterized protein LOC105962... 70 6e-11 >gb|PIN17282.1| hypothetical protein CDL12_10055 [Handroanthus impetiginosus] Length = 302 Score = 77.0 bits (188), Expect = 3e-13 Identities = 37/44 (84%), Positives = 40/44 (90%) Frame = +1 Query: 1 GLLIRDKLTVAKFLVNKTGDLDLFFSLPDTDRAEMVKMILAGQY 132 GLL+RDKL VAKFLVN+T DLDLFFSLPD DRAEMV MILAG+Y Sbjct: 259 GLLVRDKLAVAKFLVNRTADLDLFFSLPDKDRAEMVYMILAGEY 302 >ref|XP_012842474.1| PREDICTED: uncharacterized protein LOC105962703 isoform X2 [Erythranthe guttata] Length = 307 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = +1 Query: 1 GLLIRDKLTVAKFLVNKTGDLDLFFSLPDTDRAEMVKMILAGQY 132 GL I KLTVAKFLVNK GDLDLFFSLPD DR EMV MIL+G+Y Sbjct: 264 GLSIPQKLTVAKFLVNKNGDLDLFFSLPDKDRVEMVYMILSGKY 307 >ref|XP_012842473.1| PREDICTED: uncharacterized protein LOC105962703 isoform X1 [Erythranthe guttata] Length = 310 Score = 70.5 bits (171), Expect = 6e-11 Identities = 35/44 (79%), Positives = 37/44 (84%) Frame = +1 Query: 1 GLLIRDKLTVAKFLVNKTGDLDLFFSLPDTDRAEMVKMILAGQY 132 GL I KLTVAKFLVNK GDLDLFFSLPD DR EMV MIL+G+Y Sbjct: 267 GLSIPQKLTVAKFLVNKNGDLDLFFSLPDKDRVEMVYMILSGKY 310