BLASTX nr result
ID: Rehmannia29_contig00001294
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00001294 (406 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KZV31636.1| pentatricopeptide repeat-containing protein [Dorc... 66 8e-10 ref|XP_011088833.1| pentatricopeptide repeat-containing protein ... 62 1e-08 ref|XP_012847095.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 57 1e-06 >gb|KZV31636.1| pentatricopeptide repeat-containing protein [Dorcoceras hygrometricum] Length = 607 Score = 65.9 bits (159), Expect = 8e-10 Identities = 32/62 (51%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +2 Query: 224 MGYQEEFHKEMSNLEINSKNDSN-LVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFC 400 MGY +F KE + ++ + N L+L+ + V+E S KE++ DEKIQ YPMPESTLCTFC Sbjct: 1 MGYLGDFDKESGDSDMTITSPGNTLILKGKWVEEFSNKERAHDEKIQLYPMPESTLCTFC 60 Query: 401 TS 406 S Sbjct: 61 MS 62 >ref|XP_011088833.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] ref|XP_020549790.1| pentatricopeptide repeat-containing protein At5g25630 [Sesamum indicum] Length = 625 Score = 62.4 bits (150), Expect = 1e-08 Identities = 31/59 (52%), Positives = 41/59 (69%) Frame = +2 Query: 224 MGYQEEFHKEMSNLEINSKNDSNLVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFC 400 MGY EEF K+ SN +I SK+ ++ ++ +ER +E S EKIQ YP+PESTLCTFC Sbjct: 1 MGYLEEFDKDSSNSKIKSKSQASTLVLNER------QETSHGEKIQVYPIPESTLCTFC 53 >ref|XP_012847095.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g25630 [Erythranthe guttata] Length = 571 Score = 57.0 bits (136), Expect = 1e-06 Identities = 32/61 (52%), Positives = 36/61 (59%) Frame = +2 Query: 224 MGYQEEFHKEMSNLEINSKNDSNLVLRDERVQELSIKEKSRDEKIQFYPMPESTLCTFCT 403 MGY EEF KE +N EIN KN Q+ I ++S DEKI F P ES LCTFCT Sbjct: 1 MGYLEEFDKESANSEINCKN-----------QDDPIMKRSPDEKINFNPPSESPLCTFCT 49 Query: 404 S 406 S Sbjct: 50 S 50