BLASTX nr result
ID: Rehmannia29_contig00001115
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00001115 (478 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098659.1| uncharacterized protein LOC105177275 isoform... 65 2e-09 ref|XP_011098658.1| uncharacterized protein LOC105177275 isoform... 65 2e-09 ref|XP_012851167.1| PREDICTED: uncharacterized protein LOC105970... 60 8e-08 gb|EYU44137.1| hypothetical protein MIMGU_mgv1a012305mg [Erythra... 60 9e-08 ref|XP_012851160.1| PREDICTED: uncharacterized protein LOC105970... 60 9e-08 ref|XP_022843664.1| uncharacterized protein LOC111367164 isoform... 59 2e-07 gb|PIN03357.1| hypothetical protein CDL12_24121 [Handroanthus im... 59 3e-07 gb|KZV32922.1| hypothetical protein F511_01433 [Dorcoceras hygro... 58 4e-07 >ref|XP_011098659.1| uncharacterized protein LOC105177275 isoform X2 [Sesamum indicum] Length = 239 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA 113 +LKRLVENMKDKVNGSLIADYSEFK+ERPKALA Sbjct: 207 VLKRLVENMKDKVNGSLIADYSEFKRERPKALA 239 >ref|XP_011098658.1| uncharacterized protein LOC105177275 isoform X1 [Sesamum indicum] Length = 268 Score = 64.7 bits (156), Expect = 2e-09 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA 113 +LKRLVENMKDKVNGSLIADYSEFK+ERPKALA Sbjct: 236 VLKRLVENMKDKVNGSLIADYSEFKRERPKALA 268 >ref|XP_012851167.1| PREDICTED: uncharacterized protein LOC105970886 isoform X2 [Erythranthe guttata] Length = 248 Score = 60.1 bits (144), Expect = 8e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA 113 +LKRLVENMKDKVN SLI+DY+EFK+ERPKALA Sbjct: 216 VLKRLVENMKDKVNSSLISDYNEFKRERPKALA 248 >gb|EYU44137.1| hypothetical protein MIMGU_mgv1a012305mg [Erythranthe guttata] Length = 249 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA 113 +LKRLVENMKDKVN SLI+DY+EFK+ERPKALA Sbjct: 217 VLKRLVENMKDKVNSSLISDYNEFKRERPKALA 249 >ref|XP_012851160.1| PREDICTED: uncharacterized protein LOC105970886 isoform X1 [Erythranthe guttata] gb|EYU44136.1| hypothetical protein MIMGU_mgv1a012305mg [Erythranthe guttata] Length = 254 Score = 60.1 bits (144), Expect = 9e-08 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA 113 +LKRLVENMKDKVN SLI+DY+EFK+ERPKALA Sbjct: 222 VLKRLVENMKDKVNSSLISDYNEFKRERPKALA 254 >ref|XP_022843664.1| uncharacterized protein LOC111367164 isoform X1 [Olea europaea var. sylvestris] ref|XP_022843667.1| uncharacterized protein LOC111367165 isoform X1 [Olea europaea var. sylvestris] Length = 246 Score = 59.3 bits (142), Expect = 2e-07 Identities = 27/32 (84%), Positives = 32/32 (100%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKAL 116 +L+RLVENMK+KVNGSLI+DYSEFK+ERPKAL Sbjct: 214 ILRRLVENMKNKVNGSLISDYSEFKRERPKAL 245 >gb|PIN03357.1| hypothetical protein CDL12_24121 [Handroanthus impetiginosus] Length = 394 Score = 59.3 bits (142), Expect = 3e-07 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA 113 +LKRLVENMK+KV GSLIADYSEFK+ERPKALA Sbjct: 362 VLKRLVENMKNKVIGSLIADYSEFKRERPKALA 394 >gb|KZV32922.1| hypothetical protein F511_01433 [Dorcoceras hygrometricum] Length = 251 Score = 58.2 bits (139), Expect = 4e-07 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 211 LLKRLVENMKDKVNGSLIADYSEFKKERPKALA*DQQSK 95 +LKRLVENMK KVNGSLIADYS+FK+ERPK L ++ K Sbjct: 209 VLKRLVENMKQKVNGSLIADYSKFKRERPKTLRIQEKFK 247