BLASTX nr result
ID: Rehmannia29_contig00000668
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00000668 (463 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|PIN06497.1| hypothetical protein CDL12_20952 [Handroanthus im... 55 5e-12 >gb|PIN06497.1| hypothetical protein CDL12_20952 [Handroanthus impetiginosus] Length = 150 Score = 55.5 bits (132), Expect(2) = 5e-12 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = +1 Query: 262 TAPPYEETKVENSDDEEEKDMGYPSFMDREDAAPFSSGGDP 384 T PP+EE KVE SD+EEEKD + FM+RED+ PF SGGDP Sbjct: 93 TEPPHEE-KVEISDEEEEKDGEHSLFMEREDSPPFGSGGDP 132 Score = 42.7 bits (99), Expect(2) = 5e-12 Identities = 19/26 (73%), Positives = 23/26 (88%) Frame = +3 Query: 153 SMQVDATPVEDVITETQATSKEPKVV 230 S+QVDATP EDVI ET+AT+KEP+ V Sbjct: 35 SLQVDATPAEDVIIETEATAKEPQAV 60