BLASTX nr result
ID: Rehmannia29_contig00000558
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00000558 (628 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_019465450.1| PREDICTED: chlorophyll synthase, chloroplast... 77 4e-14 gb|PKI34557.1| hypothetical protein CRG98_045094 [Punica granatum] 75 1e-13 ref|XP_020276245.1| chlorophyll synthase, chloroplastic [Asparag... 77 2e-13 ref|XP_022892172.1| chlorophyll synthase, chloroplastic-like [Ol... 76 4e-13 gb|KRH07608.1| hypothetical protein GLYMA_16G098000 [Glycine max] 74 4e-13 ref|XP_015088447.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 ref|XP_016473005.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 ref|XP_011095035.1| chlorophyll synthase, chloroplastic [Sesamum... 77 6e-13 ref|XP_009762729.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 ref|XP_009606938.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum] 77 6e-13 ref|NP_001312258.1| chlorophyll synthase, chloroplastic-like [Ni... 77 6e-13 ref|XP_021970771.1| chlorophyll synthase, chloroplastic isoform ... 77 6e-13 ref|XP_017243789.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 ref|XP_015897235.1| PREDICTED: chlorophyll synthase, chloroplast... 77 6e-13 gb|AJB84630.1| chlorophyll synthase [Camellia sinensis] 77 6e-13 gb|AEI83422.1| chlorophyll synthase [Camellia sinensis] 77 6e-13 ref|XP_021970770.1| chlorophyll synthase, chloroplastic isoform ... 77 6e-13 >ref|XP_019465450.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Lupinus angustifolius] Length = 156 Score = 76.6 bits (187), Expect = 4e-14 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 120 QFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 156 >gb|PKI34557.1| hypothetical protein CRG98_045094 [Punica granatum] Length = 138 Score = 75.1 bits (183), Expect = 1e-13 Identities = 35/37 (94%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QF+YFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 102 QFQYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 138 >ref|XP_020276245.1| chlorophyll synthase, chloroplastic [Asparagus officinalis] Length = 248 Score = 76.6 bits (187), Expect = 2e-13 Identities = 36/37 (97%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 212 QFKYFLKDPVKYDVKYQASAQPFLVLGLLVTALATSH 248 >ref|XP_022892172.1| chlorophyll synthase, chloroplastic-like [Olea europaea var. sylvestris] Length = 236 Score = 75.9 bits (185), Expect = 4e-13 Identities = 36/42 (85%), Positives = 40/42 (95%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH*SSRS 126 QFKYFL+DPVKYDVKYQASAQPFLILGLL++A+ATSH SS S Sbjct: 195 QFKYFLRDPVKYDVKYQASAQPFLILGLLISAIATSHSSSSS 236 >gb|KRH07608.1| hypothetical protein GLYMA_16G098000 [Glycine max] Length = 169 Score = 74.3 bits (181), Expect = 4e-13 Identities = 35/37 (94%), Positives = 36/37 (97%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYF KDPVKYDVKYQASAQPFL+LGLLVTALATSH Sbjct: 133 QFKYFRKDPVKYDVKYQASAQPFLVLGLLVTALATSH 169 >ref|XP_015088447.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum pennellii] Length = 369 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 333 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_006366338.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum tuberosum] Length = 369 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 333 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_004246318.1| PREDICTED: chlorophyll synthase, chloroplastic [Solanum lycopersicum] Length = 369 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 333 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 369 >ref|XP_016473005.1| PREDICTED: chlorophyll synthase, chloroplastic-like [Nicotiana tabacum] Length = 373 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 337 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_011095035.1| chlorophyll synthase, chloroplastic [Sesamum indicum] Length = 373 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 337 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_009762729.1| PREDICTED: chlorophyll synthase, chloroplastic [Nicotiana sylvestris] Length = 373 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 337 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_009606938.1| PREDICTED: chlorophyll synthase, chloroplastic [Nicotiana tomentosiformis] Length = 373 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 337 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >gb|ACQ44245.1| chlorophyll synthase [Nicotiana tabacum] Length = 373 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 337 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|NP_001312258.1| chlorophyll synthase, chloroplastic-like [Nicotiana tabacum] gb|ACQ44244.1| chlorophyll synthase [Nicotiana tabacum] Length = 373 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 337 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 373 >ref|XP_021970771.1| chlorophyll synthase, chloroplastic isoform X2 [Helianthus annuus] gb|OTG23413.1| putative chlorophyll synthase protein [Helianthus annuus] Length = 374 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 374 >ref|XP_017243789.1| PREDICTED: chlorophyll synthase, chloroplastic [Daucus carota subsp. sativus] gb|KZM97244.1| hypothetical protein DCAR_015394 [Daucus carota subsp. sativus] Length = 374 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 374 >ref|XP_015897235.1| PREDICTED: chlorophyll synthase, chloroplastic [Ziziphus jujuba] Length = 374 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 374 >gb|AJB84630.1| chlorophyll synthase [Camellia sinensis] Length = 374 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 374 >gb|AEI83422.1| chlorophyll synthase [Camellia sinensis] Length = 374 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 338 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 374 >ref|XP_021970770.1| chlorophyll synthase, chloroplastic isoform X1 [Helianthus annuus] Length = 375 Score = 77.0 bits (188), Expect = 6e-13 Identities = 37/37 (100%), Positives = 37/37 (100%) Frame = +1 Query: 1 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 111 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH Sbjct: 339 QFKYFLKDPVKYDVKYQASAQPFLILGLLVTALATSH 375