BLASTX nr result
ID: Rehmannia29_contig00000281
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00000281 (838 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_015067566.1| PREDICTED: random slug protein 5 [Solanum pe... 68 1e-09 ref|XP_012856601.1| PREDICTED: random slug protein 5-like [Eryth... 68 2e-09 ref|XP_004235849.1| PREDICTED: random slug protein 5 [Solanum ly... 67 3e-09 gb|KDP22526.1| hypothetical protein JCGZ_26357 [Jatropha curcas] 66 6e-09 ref|XP_011082916.1| random slug protein 5-like [Sesamum indicum] 66 6e-09 ref|XP_012090572.1| random slug protein 5 isoform X2 [Jatropha c... 66 6e-09 gb|PNY11462.1| random slug protein 5-like [Trifolium pratense] 65 6e-09 gb|PHU23995.1| hypothetical protein BC332_09102 [Capsicum chinense] 66 7e-09 gb|PHT88561.1| hypothetical protein T459_10667 [Capsicum annuum] 66 7e-09 gb|PHT47346.1| hypothetical protein CQW23_11554 [Capsicum baccatum] 66 7e-09 ref|XP_016563050.1| PREDICTED: random slug protein 5-like [Capsi... 66 7e-09 ref|XP_012090573.1| random slug protein 5 isoform X1 [Jatropha c... 66 7e-09 ref|XP_006341468.1| PREDICTED: random slug protein 5 [Solanum tu... 66 8e-09 ref|XP_019167243.1| PREDICTED: random slug protein 5-like [Ipomo... 65 9e-09 ref|XP_013446941.1| polyphosphoinositide-binding protein [Medica... 65 9e-09 ref|XP_013446940.1| polyphosphoinositide-binding protein [Medica... 65 9e-09 ref|XP_013446942.1| polyphosphoinositide-binding protein [Medica... 65 1e-08 ref|XP_019266572.1| PREDICTED: patellin-4-like isoform X2 [Nicot... 65 1e-08 ref|XP_009622305.1| PREDICTED: random slug protein 5-like isofor... 65 1e-08 ref|XP_019241590.1| PREDICTED: random slug protein 5-like [Nicot... 65 2e-08 >ref|XP_015067566.1| PREDICTED: random slug protein 5 [Solanum pennellii] Length = 271 Score = 68.2 bits (165), Expect = 1e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L+ETLLEDIDESQLP+IYGGKM LVPIH A Sbjct: 234 ITFVENKRLKETLLEDIDESQLPDIYGGKMPLVPIHEA 271 >ref|XP_012856601.1| PREDICTED: random slug protein 5-like [Erythranthe guttata] gb|EYU21760.1| hypothetical protein MIMGU_mgv1a011582mg [Erythranthe guttata] Length = 277 Score = 67.8 bits (164), Expect = 2e-09 Identities = 31/35 (88%), Positives = 35/35 (100%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVENK+LRETLLEDIDESQLP+IYGGK+QLVP+ Sbjct: 240 IVFVENKRLRETLLEDIDESQLPDIYGGKLQLVPV 274 >ref|XP_004235849.1| PREDICTED: random slug protein 5 [Solanum lycopersicum] Length = 271 Score = 67.0 bits (162), Expect = 3e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L ETLLEDIDESQLP+IYGGKM LVPIH A Sbjct: 234 ITFVENKRLTETLLEDIDESQLPDIYGGKMPLVPIHEA 271 >gb|KDP22526.1| hypothetical protein JCGZ_26357 [Jatropha curcas] Length = 241 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVENKKL+ TLLEDIDESQ+PEIYGGKM LVPI Sbjct: 204 IVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPI 238 >ref|XP_011082916.1| random slug protein 5-like [Sesamum indicum] Length = 274 Score = 66.2 bits (160), Expect = 6e-09 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I+FVENKKL+ TLLE+IDESQLPEIYGGKMQLVPI A Sbjct: 237 IIFVENKKLQATLLEEIDESQLPEIYGGKMQLVPIQDA 274 >ref|XP_012090572.1| random slug protein 5 isoform X2 [Jatropha curcas] Length = 247 Score = 65.9 bits (159), Expect = 6e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVENKKL+ TLLEDIDESQ+PEIYGGKM LVPI Sbjct: 210 IVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPI 244 >gb|PNY11462.1| random slug protein 5-like [Trifolium pratense] Length = 204 Score = 65.1 bits (157), Expect = 6e-09 Identities = 30/35 (85%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 I+FVEN KL+ TLLEDIDESQLPEIYGGK+QLVPI Sbjct: 167 IIFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPI 201 >gb|PHU23995.1| hypothetical protein BC332_09102 [Capsicum chinense] Length = 283 Score = 66.2 bits (160), Expect = 7e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L ETLL+DIDESQLPEIYGGKM LVPIH A Sbjct: 246 ISFVENKRLTETLLQDIDESQLPEIYGGKMPLVPIHEA 283 >gb|PHT88561.1| hypothetical protein T459_10667 [Capsicum annuum] Length = 283 Score = 66.2 bits (160), Expect = 7e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L ETLL+DIDESQLPEIYGGKM LVPIH A Sbjct: 246 ISFVENKRLTETLLQDIDESQLPEIYGGKMPLVPIHEA 283 >gb|PHT47346.1| hypothetical protein CQW23_11554 [Capsicum baccatum] Length = 283 Score = 66.2 bits (160), Expect = 7e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L ETLL+DIDESQLPEIYGGKM LVPIH A Sbjct: 246 ISFVENKRLTETLLQDIDESQLPEIYGGKMPLVPIHEA 283 >ref|XP_016563050.1| PREDICTED: random slug protein 5-like [Capsicum annuum] Length = 283 Score = 66.2 bits (160), Expect = 7e-09 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L ETLL+DIDESQLPEIYGGKM LVPIH A Sbjct: 246 ISFVENKRLTETLLQDIDESQLPEIYGGKMPLVPIHEA 283 >ref|XP_012090573.1| random slug protein 5 isoform X1 [Jatropha curcas] dbj|BAJ53120.1| JHL07K02.10 [Jatropha curcas] Length = 253 Score = 65.9 bits (159), Expect = 7e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVENKKL+ TLLEDIDESQ+PEIYGGKM LVPI Sbjct: 216 IVFVENKKLKSTLLEDIDESQIPEIYGGKMSLVPI 250 >ref|XP_006341468.1| PREDICTED: random slug protein 5 [Solanum tuberosum] Length = 271 Score = 65.9 bits (159), Expect = 8e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L ETLL+DIDESQLP+IYGGKM LVPIH A Sbjct: 234 ITFVENKRLTETLLQDIDESQLPDIYGGKMPLVPIHEA 271 >ref|XP_019167243.1| PREDICTED: random slug protein 5-like [Ipomoea nil] Length = 253 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I+FVENK+L TLLEDIDESQLPEIYGGK LVPIH A Sbjct: 216 IIFVENKRLTSTLLEDIDESQLPEIYGGKQPLVPIHNA 253 >ref|XP_013446941.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|KEH20968.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 253 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVEN KL+ TLLEDIDESQLPEIYGGK+QLVPI Sbjct: 215 IVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPI 249 >ref|XP_013446940.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|KEH20967.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 255 Score = 65.5 bits (158), Expect = 9e-09 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVEN KL+ TLLEDIDESQLPEIYGGK+QLVPI Sbjct: 218 IVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPI 252 >ref|XP_013446942.1| polyphosphoinositide-binding protein [Medicago truncatula] gb|KEH20969.1| polyphosphoinositide-binding protein [Medicago truncatula] Length = 263 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/35 (88%), Positives = 33/35 (94%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPI 732 IVFVEN KL+ TLLEDIDESQLPEIYGGK+QLVPI Sbjct: 225 IVFVENNKLKSTLLEDIDESQLPEIYGGKLQLVPI 259 >ref|XP_019266572.1| PREDICTED: patellin-4-like isoform X2 [Nicotiana attenuata] Length = 241 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I+FVENK+L TLL+DIDESQ+PEIYGGKM LVPIH A Sbjct: 204 IIFVENKRLMTTLLQDIDESQIPEIYGGKMPLVPIHEA 241 >ref|XP_009622305.1| PREDICTED: random slug protein 5-like isoform X2 [Nicotiana tomentosiformis] ref|XP_016485153.1| PREDICTED: random slug protein 5-like isoform X2 [Nicotiana tabacum] Length = 259 Score = 65.1 bits (157), Expect = 1e-08 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I+FVENK+L TLL+DIDESQLPEIYGGKM LVPIH A Sbjct: 222 IMFVENKRLMTTLLQDIDESQLPEIYGGKMPLVPIHEA 259 >ref|XP_019241590.1| PREDICTED: random slug protein 5-like [Nicotiana attenuata] gb|OIT19326.1| phosphatidylinositolphosphatidylcholine transfer protein sfh1 [Nicotiana attenuata] Length = 275 Score = 65.1 bits (157), Expect = 2e-08 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = -3 Query: 836 IVFVENKKLRETLLEDIDESQLPEIYGGKMQLVPIHMA 723 I FVENK+L TLLEDIDESQ+PEIYGGKM LVPIH A Sbjct: 238 ITFVENKRLMTTLLEDIDESQIPEIYGGKMPLVPIHEA 275