BLASTX nr result
ID: Rehmannia29_contig00000243
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia29_contig00000243 (1219 letters) Database: All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRF excluding environmental samples from WGS projects 149,584,005 sequences; 54,822,741,787 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089207.1| F-box protein At2g27310 [Sesamum indicum] 59 5e-06 >ref|XP_011089207.1| F-box protein At2g27310 [Sesamum indicum] Length = 338 Score = 59.3 bits (142), Expect = 5e-06 Identities = 29/44 (65%), Positives = 30/44 (68%), Gaps = 4/44 (9%) Frame = -1 Query: 1108 CRNDCP----CNSTWPSATDRHVSAAISAFPSGHYSFYSDAFQA 989 C +DC CNSTWPS TD V AISAFPS H SFYSDAF A Sbjct: 56 CNDDCLWKDICNSTWPSTTDPRVRDAISAFPSAHRSFYSDAFPA 99