BLASTX nr result
ID: Rehmannia28_contig00054938
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054938 (428 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011087015.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O... 59 2e-07 ref|XP_012830327.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O... 57 9e-07 gb|EYU43362.1| hypothetical protein MIMGU_mgv1a019428mg [Erythra... 55 4e-06 >ref|XP_011087015.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like [Sesamum indicum] Length = 452 Score = 58.5 bits (140), Expect = 2e-07 Identities = 30/48 (62%), Positives = 34/48 (70%), Gaps = 6/48 (12%) Frame = -1 Query: 275 MGEINFKI------AMGHLTTFLHVSDKLEKKGHKIFYILSTKTQQLL 150 MGE + KI AMGHLT FLH+SDK +KGHKIF+IL TKTQ L Sbjct: 1 MGENSLKIVMYPWFAMGHLTAFLHISDKFAEKGHKIFFILPTKTQSKL 48 >ref|XP_012830327.1| PREDICTED: anthocyanidin 3-O-glucoside 2''-O-glucosyltransferase-like [Erythranthe guttata] Length = 452 Score = 56.6 bits (135), Expect = 9e-07 Identities = 30/48 (62%), Positives = 33/48 (68%), Gaps = 6/48 (12%) Frame = -1 Query: 275 MGEINFKIAM------GHLTTFLHVSDKLEKKGHKIFYILSTKTQQLL 150 MGE KIAM GHLTTFLHVS+K +KGHKIF+IL TK Q L Sbjct: 1 MGEKTMKIAMYPWFAMGHLTTFLHVSNKFAEKGHKIFFILPTKVQSKL 48 >gb|EYU43362.1| hypothetical protein MIMGU_mgv1a019428mg [Erythranthe guttata] Length = 443 Score = 54.7 bits (130), Expect = 4e-06 Identities = 25/34 (73%), Positives = 28/34 (82%) Frame = -1 Query: 251 AMGHLTTFLHVSDKLEKKGHKIFYILSTKTQQLL 150 AMGHLTTFLHVS+K +KGHKIF+IL TK Q L Sbjct: 6 AMGHLTTFLHVSNKFAEKGHKIFFILPTKVQSKL 39