BLASTX nr result
ID: Rehmannia28_contig00054926
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054926 (354 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012838660.1| PREDICTED: putative respiratory burst oxidas... 70 8e-12 gb|EYU36233.1| hypothetical protein MIMGU_mgv1a023588mg [Erythra... 69 3e-11 ref|XP_011089847.1| PREDICTED: putative respiratory burst oxidas... 63 3e-09 gb|EYU36232.1| hypothetical protein MIMGU_mgv1a018019mg [Erythra... 59 9e-08 >ref|XP_012838660.1| PREDICTED: putative respiratory burst oxidase homolog protein H [Erythranthe guttata] Length = 827 Score = 70.1 bits (170), Expect = 8e-12 Identities = 36/61 (59%), Positives = 46/61 (75%), Gaps = 6/61 (9%) Frame = +2 Query: 188 ASDISELPRGESVKWILEKIEIDNMADVPM------EDAKSESYLRRKASSIKNRNRVQD 349 ++++SEL RGESVKWILEKI+ID+M++VP+ A E YL+RK SSI RNRVQD Sbjct: 3 STEMSELSRGESVKWILEKIDIDSMSEVPILGEGQAGPASKEGYLKRKTSSIMKRNRVQD 62 Query: 350 S 352 S Sbjct: 63 S 63 >gb|EYU36233.1| hypothetical protein MIMGU_mgv1a023588mg [Erythranthe guttata] Length = 819 Score = 68.6 bits (166), Expect = 3e-11 Identities = 36/58 (62%), Positives = 43/58 (74%), Gaps = 6/58 (10%) Frame = +2 Query: 197 ISELPRGESVKWILEKIEIDNMADVPM------EDAKSESYLRRKASSIKNRNRVQDS 352 +SEL RGESVKWILEKI+ID+M++VP+ A E YL+RK SSI RNRVQDS Sbjct: 1 MSELSRGESVKWILEKIDIDSMSEVPILGEGQAGPASKEGYLKRKTSSIMKRNRVQDS 58 >ref|XP_011089847.1| PREDICTED: putative respiratory burst oxidase homolog protein H [Sesamum indicum] Length = 825 Score = 62.8 bits (151), Expect = 3e-09 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 2/57 (3%) Frame = +2 Query: 188 ASDISELPRGESVKWILEKIEIDNMADVPMEDAK--SESYLRRKASSIKNRNRVQDS 352 + +I E+P G+S +W+LEKIEID+M DVPM D + S SYL+RK+SS+K R VQ S Sbjct: 3 SKEIPEVPGGDSGQWVLEKIEIDSMVDVPMGDGQSGSASYLKRKSSSVKKRIPVQVS 59 >gb|EYU36232.1| hypothetical protein MIMGU_mgv1a018019mg [Erythranthe guttata] Length = 815 Score = 58.5 bits (140), Expect = 9e-08 Identities = 31/50 (62%), Positives = 36/50 (72%) Frame = +2 Query: 200 SELPRGESVKWILEKIEIDNMADVPMEDAKSESYLRRKASSIKNRNRVQD 349 SELP+GES KW LEKIEID M DV AK E Y ++KA+SI RN+V D Sbjct: 4 SELPKGESRKWTLEKIEIDGMEDVESGAAK-ERYAKKKANSIMKRNQVHD 52