BLASTX nr result
ID: Rehmannia28_contig00054602
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054602 (441 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094665.1| PREDICTED: ethylene-responsive transcription... 64 2e-09 >ref|XP_011094665.1| PREDICTED: ethylene-responsive transcription factor ERF087-like [Sesamum indicum] Length = 272 Score = 63.9 bits (154), Expect = 2e-09 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = -1 Query: 435 NSDGSDLGDVYSFNDQGFGDQMMGWISSPEMMSGGDRTE 319 +SDGSD+ DVYS ++QGFGDQMMGWISSPE+MS TE Sbjct: 206 DSDGSDMSDVYSLSEQGFGDQMMGWISSPEVMSAAAGTE 244