BLASTX nr result
ID: Rehmannia28_contig00054541
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054541 (375 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoe... 74 1e-13 ref|XP_013753243.1| hypothetical protein AMSG_10809 [Thecamonas ... 69 3e-12 ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoe... 60 1e-08 >ref|XP_004345357.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] gi|440800189|gb|ELR21231.1| hypothetical protein ACA1_355970 [Acanthamoeba castellanii str. Neff] Length = 229 Score = 73.9 bits (180), Expect = 1e-13 Identities = 35/108 (32%), Positives = 56/108 (51%), Gaps = 1/108 (0%) Frame = +1 Query: 52 KPVWPQAFSASVLISSNDRRRPEFTRWFSSRPEQKDRFDGLTEWKGEEYLAEIIVDHKAG 231 KP WP +SA+V SN +F R F + R G+ +WKG+ Y E + K Sbjct: 30 KPQWPSTYSATVEWRSNHHPHHKFFRMFWDEKNCRARVGGMVKWKGKHYKMEALYYGKKN 89 Query: 232 RQTNVYYDQESVVCFQFP-NNRTFPQPNFDDFEYRGLALIDYNVVLHW 372 ++Y+++ V CF N+T + D +Y+G+AL++Y+ V HW Sbjct: 90 AAYYIFYERDQVKCFTMDLKNKTIKGLDLSDADYKGMALVEYHPVYHW 137 >ref|XP_013753243.1| hypothetical protein AMSG_10809 [Thecamonas trahens ATCC 50062] gi|906561948|gb|KNC55191.1| hypothetical protein AMSG_10809 [Thecamonas trahens ATCC 50062] Length = 164 Score = 68.9 bits (167), Expect = 3e-12 Identities = 38/90 (42%), Positives = 46/90 (51%), Gaps = 1/90 (1%) Frame = +1 Query: 106 RRRPEFTRWFSSRPEQKDRFDGLTEWKGEEYLAEIIVDHKAGRQTNVYYDQESVVC-FQF 282 RRRP+F RWF S+ Q R DG E GE Y D K + V+Y SV C Q Sbjct: 7 RRRPQFFRWFVSQTHQVARVDGAVEHHGETYGFSEYADFKREKADQVFYGMNSVFCESQK 66 Query: 283 PNNRTFPQPNFDDFEYRGLALIDYNVVLHW 372 +N T P PNF+ FE+ G ID+ V W Sbjct: 67 MHNGTMPIPNFEHFEFVGEGDIDFQTVYIW 96 >ref|XP_004348357.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] gi|440800957|gb|ELR21983.1| hypothetical protein ACA1_325550 [Acanthamoeba castellanii str. Neff] Length = 224 Score = 60.5 bits (145), Expect = 1e-08 Identities = 33/107 (30%), Positives = 47/107 (43%) Frame = +1 Query: 52 KPVWPQAFSASVLISSNDRRRPEFTRWFSSRPEQKDRFDGLTEWKGEEYLAEIIVDHKAG 231 KP P AFSA+V + N + E+ RWF QK R D L E GE I DH Sbjct: 30 KPTLPPAFSAAVHVQRNYKPYQEYFRWFRDEKLQKARVDRLAEVHGETLFHSFIYDHSEQ 89 Query: 232 RQTNVYYDQESVVCFQFPNNRTFPQPNFDDFEYRGLALIDYNVVLHW 372 + V++ E CF + + E+ G + + ++ V HW Sbjct: 90 KMFAVFFRGEVATCFTKTIRGNLTHFDLSEAEFLGKSYVYFDPVYHW 136