BLASTX nr result
ID: Rehmannia28_contig00054421
seq
BLASTX 2.2.26 [Sep-21-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Rehmannia28_contig00054421 (629 letters) Database: ./nr 84,704,028 sequences; 31,038,470,784 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831463.1| PREDICTED: ankyrin repeat-containing protein... 67 9e-10 ref|XP_012831464.1| PREDICTED: ankyrin repeat-containing protein... 57 3e-06 gb|EYU42336.1| hypothetical protein MIMGU_mgv11b017551mg, partia... 57 3e-06 ref|XP_011093263.1| PREDICTED: ankyrin repeat-containing protein... 57 4e-06 >ref|XP_012831463.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Erythranthe guttata] Length = 454 Score = 67.4 bits (163), Expect = 9e-10 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 628 IAITPSGAISVCFIALSVVMPIGMPMLTKVVRDYKKGRRQCELPST 491 +AITPSG +SV FIALSVVMPI MP+LT VVRDY+KG R+CE S+ Sbjct: 403 VAITPSGYVSVFFIALSVVMPIVMPLLTMVVRDYRKGWRRCESSSS 448 >ref|XP_012831464.1| PREDICTED: ankyrin repeat-containing protein At5g02620-like [Erythranthe guttata] Length = 443 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 628 IAITPSGAISVCFIALSVVMPIGMPMLTKVVRDYKKGRRQCELPS 494 +AI PSG ISV F+A+SVVM + +PMLTKVVRD+ K R+ ELP+ Sbjct: 399 VAIAPSGMISVFFVAVSVVMSLVVPMLTKVVRDHNKWWRRSELPA 443 >gb|EYU42336.1| hypothetical protein MIMGU_mgv11b017551mg, partial [Erythranthe guttata] Length = 577 Score = 57.0 bits (136), Expect = 3e-06 Identities = 28/45 (62%), Positives = 36/45 (80%) Frame = -2 Query: 628 IAITPSGAISVCFIALSVVMPIGMPMLTKVVRDYKKGRRQCELPS 494 +AI PSG ISV F+A+SVVM + +PMLTKVVRD+ K R+ ELP+ Sbjct: 399 VAIAPSGMISVFFVAVSVVMSLVVPMLTKVVRDHNKWWRRSELPA 443 >ref|XP_011093263.1| PREDICTED: ankyrin repeat-containing protein At2g01680-like [Sesamum indicum] Length = 460 Score = 56.6 bits (135), Expect = 4e-06 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = -2 Query: 628 IAITPSGAISVCFIALSVVMPIGMPMLTKVVRDYKKGRRQCELPSTRDSS 479 +AITP+G I V FI LS+VMP MP+LT VVRDY + RQ ELP+ +S Sbjct: 410 VAITPNGWILVLFIVLSIVMPFIMPVLTIVVRDYNRKGRQYELPAQGQAS 459